GCG (glucagon)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2641
Gene name Glucagon
Gene symbol GCG
Synonyms (NCBI Gene)
GLP-1GLP1GLP2GRPP
Chromosome 2
Chromosome location 2q24.2
Summary The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluc
miRNA miRNA information provided by mirtarbase database.
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (22)
miRTarBase ID miRNA Experiments Reference
MIRT444741 hsa-miR-4699-5p PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 PAR-CLIP 22100165
MIRT444741 hsa-miR-4699-5p PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 PAR-CLIP 22100165
MIRT444740 hsa-miR-3611 Western blottingqRT-PCR 35071451
Transcription factors Transcription factors information provided by TRRUST V2 database.
6
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (6)
Transcription factor Regulation Reference
FOXA1 Unknown 15828872;21824252
FOXA2 Unknown 15828872
ISL1 Unknown 21824252
PAX4 Repression 17426099
PAX6 Unknown 21824252
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (42)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 9990065
GO:0005179 Function Hormone activity IBA
GO:0005179 Function Hormone activity IEA
GO:0005515 Function Protein binding IPI 17051221, 17715056, 21314817
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
138030 4191 ENSG00000115263
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01275
Protein name Pro-glucagon [Cleaved into: Glicentin; Glicentin-related polypeptide (GRPP); Oxyntomodulin (OXM) (OXY); Glucagon; Glucagon-like peptide 1 (GLP-1) (Incretin hormone); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));
Protein function [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-indu
PDB 1BH0 , 1D0R , 1NAU , 2G49 , 2L63 , 2L64 , 2M5P , 2M5Q , 3IOL , 4APD , 4ZGM , 5OTU , 5OTV , 5OTW , 5OTX , 5VAI , 5YQZ , 6EDS , 6LMK , 6LML , 6NZN , 6PHI , 6PHJ , 6PHK , 6PHL , 6PHO , 6PHP , 6VCB , 6X18 , 7D68 , 7DUQ , 7KI0 , 7KI1 , 7XM8 , 8ANJ , 8ANK , 8JRV , 9IVG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00123 Hormone_2 53 → 80 Peptide hormone Family
PF00123 Hormone_2 98 → 125 Peptide hormone Family
PF00123 Hormone_2 146 → 173 Peptide hormone Family
Tissue specificity TISSUE SPECIFICITY: [Glucagon]: Secreted in the A cells of the islets of Langerhans. {ECO:0000269|PubMed:22037645}.; TISSUE SPECIFICITY: [Glucagon-like peptide 1]: Secreted in the A cells of the islets of Langerhans (PubMed:22037645). Secreted from entero
Sequence 
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Sequence length 180
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Thermogenesis
Insulin secretion
Glucagon signaling pathway 		  Glucagon signaling in metabolic regulation
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
G alpha (q) signalling events
G alpha (s) signalling events
Glucagon-type ligand receptors
Synthesis, secretion, and deacylation of Ghrelin
ADORA2B mediated anti-inflammatory cytokines production
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (28)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMERS DISEASE — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRADYCARDIA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CATALEPSY — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (350)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acromegaly Acromegaly BEFREE 30948746
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 28105738, 30561221, 31091214
★★★★★
★☆☆☆☆
Found in Text Mining only
Addison Disease Addison`s Disease BEFREE 30476180
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma LHGDN 12174892
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 31300257
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 29539609
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 29539609
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 1940028
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenal Cortical Adenoma Adrenocortical adenoma BEFREE 15326569
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenal Gland Pheochromocytoma Adrenal Gland Pheochromocytoma BEFREE 11311729
★★★★★
★☆☆☆☆
Found in Text Mining only