Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26354
Gene name	G protein nucleolar 3
Gene symbol	GNL3
Synonyms (NCBI Gene)	C77032E2IG3NNP47NSNug1
Chromosome	3
Chromosome location	3p21.1
Summary	The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants e

217

Show/Hide all (217)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029281	hsa-miR-26b-5p	Microarray	19088304
MIRT047156	hsa-miR-183-5p	CLASH	23622248
MIRT039623	hsa-miR-615-3p	CLASH	23622248
MIRT039623	hsa-miR-615-3p	CLASH	23622248
MIRT237525	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT307993	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT550270	hsa-miR-5692b	PAR-CLIP	20371350
MIRT550269	hsa-miR-5692c	PAR-CLIP	20371350
MIRT550268	hsa-miR-6074	PAR-CLIP	20371350
MIRT550267	hsa-miR-4719	PAR-CLIP	20371350
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT237528	hsa-miR-1254	PAR-CLIP	20371350
MIRT237529	hsa-miR-3116	PAR-CLIP	20371350
MIRT237526	hsa-miR-661	PAR-CLIP	20371350
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT307994	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT550266	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT237525	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT307993	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT550270	hsa-miR-5692b	PAR-CLIP	20371350
MIRT550269	hsa-miR-5692c	PAR-CLIP	20371350
MIRT550268	hsa-miR-6074	PAR-CLIP	20371350
MIRT550267	hsa-miR-4719	PAR-CLIP	20371350
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT237528	hsa-miR-1254	PAR-CLIP	20371350
MIRT237529	hsa-miR-3116	PAR-CLIP	20371350
MIRT237526	hsa-miR-661	PAR-CLIP	20371350
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT307994	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT550266	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT237525	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT307993	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT550270	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550269	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550268	hsa-miR-6074	PAR-CLIP	21572407
MIRT550267	hsa-miR-4719	PAR-CLIP	21572407
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	21572407
MIRT237528	hsa-miR-1254	PAR-CLIP	21572407
MIRT237529	hsa-miR-3116	PAR-CLIP	21572407
MIRT237526	hsa-miR-661	PAR-CLIP	21572407
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT307994	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT550266	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	21572407
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	21572407
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	21572407
MIRT237525	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT307993	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT550270	hsa-miR-5692b	PAR-CLIP	20371350
MIRT550269	hsa-miR-5692c	PAR-CLIP	20371350
MIRT550268	hsa-miR-6074	PAR-CLIP	20371350
MIRT550267	hsa-miR-4719	PAR-CLIP	20371350
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT237528	hsa-miR-1254	PAR-CLIP	20371350
MIRT237529	hsa-miR-3116	PAR-CLIP	20371350
MIRT237526	hsa-miR-661	PAR-CLIP	20371350
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT307994	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT550266	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT237525	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT307993	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT550270	hsa-miR-5692b	PAR-CLIP	20371350
MIRT550269	hsa-miR-5692c	PAR-CLIP	20371350
MIRT550268	hsa-miR-6074	PAR-CLIP	20371350
MIRT550267	hsa-miR-4719	PAR-CLIP	20371350
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	20371350
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT237528	hsa-miR-1254	PAR-CLIP	20371350
MIRT237529	hsa-miR-3116	PAR-CLIP	20371350
MIRT237526	hsa-miR-661	PAR-CLIP	20371350
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	20371350
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT307994	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT550266	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	20371350
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	20371350
MIRT237525	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT550271	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT307996	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT307993	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT550270	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550269	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550268	hsa-miR-6074	PAR-CLIP	21572407
MIRT550267	hsa-miR-4719	PAR-CLIP	21572407
MIRT237531	hsa-miR-3691-3p	PAR-CLIP	21572407
MIRT237521	hsa-miR-29b-1-5p	PAR-CLIP	21572407
MIRT237528	hsa-miR-1254	PAR-CLIP	21572407
MIRT237529	hsa-miR-3116	PAR-CLIP	21572407
MIRT237526	hsa-miR-661	PAR-CLIP	21572407
MIRT237532	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT307995	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT307994	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT550266	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT237523	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT237527	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT550265	hsa-miR-513b-5p	PAR-CLIP	21572407
MIRT550264	hsa-miR-6894-3p	PAR-CLIP	21572407
MIRT550263	hsa-miR-6514-3p	PAR-CLIP	21572407
MIRT1024663	hsa-miR-1273f	CLIP-seq
MIRT1024664	hsa-miR-143	CLIP-seq
MIRT1024665	hsa-miR-219-2-3p	CLIP-seq
MIRT1024666	hsa-miR-2964a-3p	CLIP-seq
MIRT1024667	hsa-miR-4708-5p	CLIP-seq
MIRT1024668	hsa-miR-4770	CLIP-seq
MIRT1024669	hsa-miR-511	CLIP-seq
MIRT1024663	hsa-miR-1273f	CLIP-seq
MIRT1024664	hsa-miR-143	CLIP-seq
MIRT1024665	hsa-miR-219-2-3p	CLIP-seq
MIRT2003901	hsa-miR-2909	CLIP-seq
MIRT1024666	hsa-miR-2964a-3p	CLIP-seq
MIRT2003902	hsa-miR-3162-5p	CLIP-seq
MIRT2003903	hsa-miR-374a	CLIP-seq
MIRT2003904	hsa-miR-374b	CLIP-seq
MIRT2003905	hsa-miR-374c	CLIP-seq
MIRT2003906	hsa-miR-3941	CLIP-seq
MIRT2003907	hsa-miR-4282	CLIP-seq
MIRT2003908	hsa-miR-466	CLIP-seq
MIRT2003909	hsa-miR-4672	CLIP-seq
MIRT1024667	hsa-miR-4708-5p	CLIP-seq
MIRT1024668	hsa-miR-4770	CLIP-seq
MIRT1024669	hsa-miR-511	CLIP-seq
MIRT2003910	hsa-miR-513b	CLIP-seq
MIRT2003911	hsa-miR-655	CLIP-seq
MIRT2003912	hsa-miR-889	CLIP-seq
MIRT2003903	hsa-miR-374a	CLIP-seq
MIRT2003904	hsa-miR-374b	CLIP-seq
MIRT2236667	hsa-miR-3919	CLIP-seq
MIRT2236668	hsa-miR-3925-5p	CLIP-seq
MIRT2003906	hsa-miR-3941	CLIP-seq
MIRT2236669	hsa-miR-4274	CLIP-seq
MIRT2003907	hsa-miR-4282	CLIP-seq
MIRT2236670	hsa-miR-4519	CLIP-seq
MIRT2236671	hsa-miR-4524	CLIP-seq
MIRT2003908	hsa-miR-466	CLIP-seq
MIRT2003909	hsa-miR-4672	CLIP-seq
MIRT2236672	hsa-miR-4773	CLIP-seq
MIRT2236673	hsa-miR-4789-5p	CLIP-seq
MIRT2236674	hsa-miR-4797-5p	CLIP-seq
MIRT2003910	hsa-miR-513b	CLIP-seq
MIRT2236675	hsa-miR-622	CLIP-seq
MIRT2003912	hsa-miR-889	CLIP-seq
MIRT1024663	hsa-miR-1273f	CLIP-seq
MIRT1024664	hsa-miR-143	CLIP-seq
MIRT1024665	hsa-miR-219-2-3p	CLIP-seq
MIRT1024666	hsa-miR-2964a-3p	CLIP-seq
MIRT2540586	hsa-miR-3662	CLIP-seq
MIRT2236667	hsa-miR-3919	CLIP-seq
MIRT2236668	hsa-miR-3925-5p	CLIP-seq
MIRT2236669	hsa-miR-4274	CLIP-seq
MIRT2236670	hsa-miR-4519	CLIP-seq
MIRT2236671	hsa-miR-4524	CLIP-seq
MIRT1024667	hsa-miR-4708-5p	CLIP-seq
MIRT2540587	hsa-miR-4720-3p	CLIP-seq
MIRT1024668	hsa-miR-4770	CLIP-seq
MIRT2236672	hsa-miR-4773	CLIP-seq
MIRT2236673	hsa-miR-4789-5p	CLIP-seq
MIRT2236674	hsa-miR-4797-5p	CLIP-seq
MIRT2540588	hsa-miR-4804-3p	CLIP-seq
MIRT1024669	hsa-miR-511	CLIP-seq
MIRT2236675	hsa-miR-622	CLIP-seq
MIRT1024663	hsa-miR-1273f	CLIP-seq
MIRT1024664	hsa-miR-143	CLIP-seq
MIRT1024665	hsa-miR-219-2-3p	CLIP-seq
MIRT1024666	hsa-miR-2964a-3p	CLIP-seq
MIRT2540586	hsa-miR-3662	CLIP-seq
MIRT2236667	hsa-miR-3919	CLIP-seq
MIRT2236668	hsa-miR-3925-5p	CLIP-seq
MIRT2236669	hsa-miR-4274	CLIP-seq
MIRT2236670	hsa-miR-4519	CLIP-seq
MIRT2236671	hsa-miR-4524	CLIP-seq
MIRT1024667	hsa-miR-4708-5p	CLIP-seq
MIRT2540587	hsa-miR-4720-3p	CLIP-seq
MIRT1024668	hsa-miR-4770	CLIP-seq
MIRT2236672	hsa-miR-4773	CLIP-seq
MIRT2236673	hsa-miR-4789-5p	CLIP-seq
MIRT2236674	hsa-miR-4797-5p	CLIP-seq
MIRT2540588	hsa-miR-4804-3p	CLIP-seq
MIRT1024669	hsa-miR-511	CLIP-seq
MIRT2236675	hsa-miR-622	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	16097049, 17932509, 19487455, 21132010, 21988832, 22641345, 24550003, 24965446, 26638075, 32296183, 33961781, 34681573
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IEA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	22641345
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016604	Component	Nuclear body	IDA
GO:0017145	Process	Stem cell division	IDA	25522312
GO:0019827	Process	Stem cell population maintenance	IMP	25522312
GO:0030496	Component	Midbody	IDA
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	22641345
GO:0033235	Process	Positive regulation of protein sumoylation	IMP	22641345
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	ISS
GO:0048027	Function	MRNA 5'-UTR binding	IDA	16213212
GO:1902895	Process	Positive regulation of miRNA transcription	IMP	25569094
GO:1904816	Process	Positive regulation of protein localization to chromosome, telomeric region	IMP	22641345

MIM	HGNC	e!Ensembl
608011	29931	ENSG00000163938

Q9BVP2

Protein name

Guanine nucleotide-binding protein-like 3 (E2-induced gene 3 protein) (Novel nucleolar protein 47) (NNP47) (Nucleolar GTP-binding protein 3) (Nucleostemin)

Protein function

May be required to maintain the proliferative capacity of stem cells. Stabilizes MDM2 by preventing its ubiquitination, and hence proteasomal degradation (By similarity).

PDB

8FKP , 8FKR , 8FKT , 8FKU , 8FKV , 8FKW , 8FKX , 8FKY , 8FKZ , 8FL0 , 8FL2 , 8FL3 , 8FL4 , 8INK , 8IPD , 8IPX , 8IPY , 8IR1 , 8IR3 , 8RL2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08701	GN3L_Grn1	16 → 89	GNL3L/Grn1 putative GTPase	Family
PF01926	MMR_HSR1	256 → 367	50S ribosome-binding GTPase	Family

Tissue specificity

TISSUE SPECIFICITY: Increased levels in lung tissue in cancer patients. {ECO:0000269|PubMed:16012751}.

Sequence

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEAL
LREAELRKQRLEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAK
SGKQNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKS
DLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPFRSEVCFGKEGL
WKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQ
ITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRN
SLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERK
QEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDD
AYDFSTDYV

Sequence length

549

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes		Major pathway of rRNA processing in the nucleolus and cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24119536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29096331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	19449081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	22182935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	29947131	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19706044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	21242306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24610951, 24716972, 25209720, 25880415, 30817632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24610951, 24650343, 24716972, 30817632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16670719, 18419830, 26722529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26517370, 32051231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19706044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16012751, 22424632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17970071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28412352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18419830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24762489, 28849076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24762489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28849076	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22763110, 24886551, 27066995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASDB_DG	22763110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	22763110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22050045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22050045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22404757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24763828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22174890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17970071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	35886999	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	32051231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24912530, 29096331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24119536, 24912530, 24960197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26517370, 27998760, 28476378, 31785228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	15112336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22424632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19823871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21242306, 22081066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	22472876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24650343, 25209720, 25880415, 30692636, 30817632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22404757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16012751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28412352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18304460, 20664182, 26429724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15112336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19706044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15112336, 16012751, 16670719, 17000083, 18519946, 19823871, 20572164, 21443540, 21730156, 22050045, 22081066, 22174890, 24716972, 24763828, 25209720, 25314067, 28412352, 28849076 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24762489, 28849076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30692636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	20572164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21242306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16012751, 18419830, 19823871, 20572164, 21045149, 21730156, 22050045, 22081066, 22156015, 24650343, 24716972, 24912530, 25880415, 27998760, 28849076, 30817632, 31785228 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31115526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22763110, 24886551, 36167888	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	29942097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30374069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29942097		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	LHGDN	18448670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21242306, 30936750		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28412352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24628257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18304460, 20664182, 26429724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29947131, 31723243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	29947131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	21655359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22050045, 25314067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19823871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17970071, 25314067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15112336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15112336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24763828, 26722529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30817632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30817632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19706044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18419830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GNL3 (G protein nucleolar 3)