Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2634
Gene name	Guanylate binding protein 2
Gene symbol	GBP2
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p22.2
Summary	This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017798	hsa-miR-335-5p	Microarray	18185580
MIRT029407	hsa-miR-26b-5p	Microarray	19088304
MIRT573882	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573881	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT573880	hsa-miR-6806-5p	PAR-CLIP	20371350
MIRT573882	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573881	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT573880	hsa-miR-6806-5p	PAR-CLIP	20371350
MIRT756350	hsa-miR-221-3p	Luciferase reporter assayWestern blottingqRT-PCR	38450521
MIRT2537618	hsa-miR-1178	CLIP-seq
MIRT2537619	hsa-miR-1269	CLIP-seq
MIRT2537620	hsa-miR-1269b	CLIP-seq
MIRT2537621	hsa-miR-2110	CLIP-seq
MIRT2537622	hsa-miR-3117-5p	CLIP-seq
MIRT2537623	hsa-miR-3150a-3p	CLIP-seq
MIRT2537624	hsa-miR-3175	CLIP-seq
MIRT2537625	hsa-miR-3189-3p	CLIP-seq
MIRT2537626	hsa-miR-4268	CLIP-seq
MIRT2537627	hsa-miR-4300	CLIP-seq
MIRT2537628	hsa-miR-4419a	CLIP-seq
MIRT2537629	hsa-miR-4448	CLIP-seq
MIRT2537630	hsa-miR-4487	CLIP-seq
MIRT2537631	hsa-miR-4510	CLIP-seq
MIRT2537632	hsa-miR-4520a-3p	CLIP-seq
MIRT2537633	hsa-miR-4529-3p	CLIP-seq
MIRT2537634	hsa-miR-4638-3p	CLIP-seq
MIRT2537635	hsa-miR-4670-3p	CLIP-seq
MIRT2537636	hsa-miR-4714-5p	CLIP-seq
MIRT2537637	hsa-miR-4742-5p	CLIP-seq
MIRT2537638	hsa-miR-514	CLIP-seq
MIRT2537639	hsa-miR-514b-3p	CLIP-seq
MIRT2537640	hsa-miR-578	CLIP-seq
MIRT2537641	hsa-miR-635	CLIP-seq
MIRT2537642	hsa-miR-920	CLIP-seq
MIRT2537643	hsa-miR-939	CLIP-seq
MIRT2537618	hsa-miR-1178	CLIP-seq
MIRT2537619	hsa-miR-1269	CLIP-seq
MIRT2537620	hsa-miR-1269b	CLIP-seq
MIRT2537621	hsa-miR-2110	CLIP-seq
MIRT2537622	hsa-miR-3117-5p	CLIP-seq
MIRT2537623	hsa-miR-3150a-3p	CLIP-seq
MIRT2537624	hsa-miR-3175	CLIP-seq
MIRT2537625	hsa-miR-3189-3p	CLIP-seq
MIRT2537626	hsa-miR-4268	CLIP-seq
MIRT2537627	hsa-miR-4300	CLIP-seq
MIRT2537628	hsa-miR-4419a	CLIP-seq
MIRT2537629	hsa-miR-4448	CLIP-seq
MIRT2537630	hsa-miR-4487	CLIP-seq
MIRT2537631	hsa-miR-4510	CLIP-seq
MIRT2537632	hsa-miR-4520a-3p	CLIP-seq
MIRT2537633	hsa-miR-4529-3p	CLIP-seq
MIRT2537634	hsa-miR-4638-3p	CLIP-seq
MIRT2537635	hsa-miR-4670-3p	CLIP-seq
MIRT2537636	hsa-miR-4714-5p	CLIP-seq
MIRT2537637	hsa-miR-4742-5p	CLIP-seq
MIRT2537638	hsa-miR-514	CLIP-seq
MIRT2537639	hsa-miR-514b-3p	CLIP-seq
MIRT2537640	hsa-miR-578	CLIP-seq
MIRT2537641	hsa-miR-635	CLIP-seq
MIRT2537642	hsa-miR-920	CLIP-seq
MIRT2537643	hsa-miR-939	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	31091448
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002218	Process	Activation of innate immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0004866	Function	Endopeptidase inhibitor activity	IDA	31091448
GO:0005515	Function	Protein binding	IPI	18985028, 21151871, 28514442, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS	1715024
GO:0005634	Component	Nucleus	IDA	17266443, 21151871
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21151871
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA	31091448
GO:0005794	Component	Golgi apparatus	IDA	17266443
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006955	Process	Immune response	TAS	1715024
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0034504	Process	Protein localization to nucleus	IDA	21151871
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	IPI	21151871
GO:0042803	Function	Protein homodimerization activity	IDA	21151871
GO:0042832	Process	Defense response to protozoan	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046718	Process	Symbiont entry into host cell	IDA	9641677
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17266443
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0051604	Process	Protein maturation	IDA	31091448
GO:0051607	Process	Defense response to virus	IDA	31091448
GO:0051715	Process	Cytolysis in another organism	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071346	Process	Cellular response to type II interferon	IBA
GO:0071346	Process	Cellular response to type II interferon	IDA	17266443
GO:0071347	Process	Cellular response to interleukin-1	IEP	17266443
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	17266443
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	ISS
GO:0140678	Function	Molecular function inhibitor activity	IDA	31091448
GO:0140973	Process	Positive regulation of AIM2 inflammasome complex assembly	ISS

MIM	HGNC	e!Ensembl
600412	4183	ENSG00000162645

P32456

Protein name

Guanylate-binding protein 2 (EC 3.6.5.-) (GTP-binding protein 2) (GBP-2) (HuGBP-2) (Guanine nucleotide-binding protein 2) (Interferon-induced guanylate-binding protein 2)

Protein function

Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens (PubMed:31091448). Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions, but the major react

PDB

6VKJ , 7E58 , 7M1S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02263	GBP	18 → 280	Guanylate-binding protein, N-terminal domain	Domain
PF02841	GBP_C	282 → 578	Guanylate-binding protein, C-terminal domain	Domain

Sequence

MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL
RDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA
PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN
AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQELLDLHRDSER
EAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSL
SEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQL
MAEQEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

Sequence length

591

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway		Interferon gamma signaling Interferon alpha/beta signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Inherited susceptibility to mycobacterial diseases	Likely risk allele	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	31781157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23001506, 29072687, 30425235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31311202, 35233733, 37784054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35730811, 39251636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35730811, 37551111, 39251636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36660930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31489998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37924005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	32846838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31311364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37622120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20617533	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20617533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	36115937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23001506, 29072687, 30425235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33688507, 37784054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	31600201	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	23001506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38169731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22246450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27806724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34993253	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33316779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28974614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	20617533	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19003964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37784054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34708131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GBP2 (guanylate binding protein 2)