Gene Gene information from NCBI Gene database.
Entrez ID 26268
Gene name F-box protein 9
Gene symbol FBXO9
Synonyms (NCBI Gene)
FBX9NY-REN-57VCIA1dJ341E18.2
Chromosome 6
Chromosome location 6p12.1
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
346
miRTarBase ID miRNA Experiments Reference
MIRT523751 hsa-miR-8485 HITS-CLIP 21572407
MIRT523750 hsa-miR-329-3p HITS-CLIP 21572407
MIRT523749 hsa-miR-362-3p HITS-CLIP 21572407
MIRT523748 hsa-miR-603 HITS-CLIP 21572407
MIRT523747 hsa-miR-3941 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex NAS 10531035, 10531037
GO:0004842 Function Ubiquitin-protein transferase activity NAS 10531035, 10531037
GO:0005515 Function Protein binding IPI 22632967, 23263282, 27705803, 32296183, 33961781
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 23263282
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609091 13588 ENSG00000112146
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UK97
Protein name F-box only protein 9 (Cross-immune reaction antigen 1) (Renal carcinoma antigen NY-REN-57)
Protein function Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins and plays a role in several biological processes s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 186 238 F-box domain Domain
Sequence
MPDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSS
SNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRA
MQLVPDIEFKITYTRSPDGDGVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPE
LESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARDPEIWRLACLKV
WGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYI
RFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKE
EKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVS
AFEIDKMYTPLFFARVRSYTAFSERPL
Sequence length 447
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Hepatocellular carcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Brain Diseases Brain disease Pubtator 29484035 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral Palsy Cerebral palsy Pubtator 29484035 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes mellitus Pubtator 20966391 Associate
★☆☆☆☆
Found in Text Mining only
leukemia Leukemia BEFREE 31684170
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia BEFREE 31684170
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma BEFREE 23263282
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 38136595 Associate
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease BEFREE 27173356
★☆☆☆☆
Found in Text Mining only
Retinoblastoma Retinoblastoma Pubtator 34347012 Associate
★☆☆☆☆
Found in Text Mining only
Thyroid Cancer Papillary Papillary thyroid cancer Pubtator 17914110 Associate
★☆☆☆☆
Found in Text Mining only