SLC13A4 (solute carrier family 13 member 4)

Gene

• Entrez ID: 26266
• Gene name: Solute carrier family 13 member 4
• Gene symbol: SLC13A4
• Synonyms (NCBI Gene): NAS2, SUT-1, SUT1
• Chromosome: 7
• Chromosome location: 7q33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017301	hsa-miR-335-5p	Microarray	18185580
MIRT029042	hsa-miR-26b-5p	Microarray	19088304
MIRT497552	hsa-miR-6815-5p	PAR-CLIP	22291592
MIRT497551	hsa-miR-6865-5p	PAR-CLIP	22291592
MIRT497550	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT497549	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT497548	hsa-miR-17-3p	PAR-CLIP	22291592
MIRT497547	hsa-miR-7854-3p	PAR-CLIP	22291592
MIRT497546	hsa-miR-6134	PAR-CLIP	22291592
MIRT497545	hsa-miR-145-3p	PAR-CLIP	22291592
MIRT497544	hsa-miR-3074-5p	PAR-CLIP	22291592
MIRT497552	hsa-miR-6815-5p	PAR-CLIP	22291592
MIRT497551	hsa-miR-6865-5p	PAR-CLIP	22291592
MIRT497550	hsa-miR-3614-5p	PAR-CLIP	22291592
MIRT497549	hsa-miR-6500-3p	PAR-CLIP	22291592
MIRT497548	hsa-miR-17-3p	PAR-CLIP	22291592
MIRT497547	hsa-miR-7854-3p	PAR-CLIP	22291592
MIRT497546	hsa-miR-6134	PAR-CLIP	22291592
MIRT497545	hsa-miR-145-3p	PAR-CLIP	22291592
MIRT497544	hsa-miR-3074-5p	PAR-CLIP	22291592
MIRT2104363	hsa-miR-3616-3p	CLIP-seq
MIRT2104364	hsa-miR-4436b-3p	CLIP-seq
MIRT2104365	hsa-miR-4721	CLIP-seq
MIRT2623237	hsa-miR-1273g	CLIP-seq
MIRT2623238	hsa-miR-1914	CLIP-seq
MIRT2623239	hsa-miR-193a-3p	CLIP-seq
MIRT2623240	hsa-miR-193b	CLIP-seq
MIRT2623241	hsa-miR-3147	CLIP-seq
MIRT2623242	hsa-miR-4660	CLIP-seq
MIRT2623243	hsa-miR-885-3p	CLIP-seq
MIRT2623244	hsa-miR-892b	CLIP-seq
MIRT2623237	hsa-miR-1273g	CLIP-seq
MIRT2623238	hsa-miR-1914	CLIP-seq
MIRT2623239	hsa-miR-193a-3p	CLIP-seq
MIRT2623240	hsa-miR-193b	CLIP-seq
MIRT2623241	hsa-miR-3147	CLIP-seq
MIRT2623242	hsa-miR-4660	CLIP-seq
MIRT2623243	hsa-miR-885-3p	CLIP-seq
MIRT2623244	hsa-miR-892b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KLF7	Unknown	23485456
SP1	Unknown	23485456
ZIC2	Unknown	23485456

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	10535998
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0015382	Function	Sodium:sulfate symporter activity	IDA	10535998, 15607730
GO:0015382	Function	Sodium:sulfate symporter activity	TAS	10535998
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:1902358	Process	Sulfate transmembrane transport	TAS	10535998

Other IDs

• MIM: 604309
• HGNC: 15827
• e!Ensembl: ENSG00000164707

Protein

• UniProt ID: Q9UKG4
• Protein name: Solute carrier family 13 member 4 (Na(+)/sulfate cotransporter SUT-1) (NaS2)
• Protein function: Sodium:sulfate symporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00939	Na_sulph_symp	5 → 610	Sodium:sulfate symporter transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in placenta and testis with intermediate levels in brain and lower levels in heart, thymus and liver. {ECO:0000269|PubMed:10535998, ECO:0000269|PubMed:15607730}.
• Sequence:

  MGLLQGLLRVRKLLLVVCVPLLLLPLPVLHPSSEASCAYVLIVTAVYWVSEAVPLGAAAL
  VPAFLYPFFGVLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKP
  GMLLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPIS
  LDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKP
  QVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTIIGTSTSLIFLEHFNNQ
  YPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKKKTKREQLSEK
  RIQEEYEKLGDISYPEMVTGFFFILMTVLWFTREPGFVPGWDSFFEKKGYRTDATVSVFL
  GFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGS
  KSSGLSTWIGNQMLSLSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLH
  INPLYTLIPVTMCISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAI
  NTWGVSLFHLDTYPAWARVSNITDQA

• Sequence length: 626

Pathways

Reactome:

Sodium-coupled sulphate, di- and tri-carboxylate transporters

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	25226513		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34840533	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	25226513		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34840533	Associate	★☆☆☆☆ Found in Text Mining only