Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26263
Gene name	F-box protein 22
Gene symbol	FBXO22
Synonyms (NCBI Gene)	FBX22FISTC1TYMAS
Chromosome	15
Chromosome location	15q24.2
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

183

Show/Hide all (183)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046543	hsa-miR-1-3p	CLASH	23622248
MIRT044372	hsa-miR-106b-5p	CLASH	23622248
MIRT537422	hsa-miR-5692b	PAR-CLIP	22012620
MIRT537421	hsa-miR-5692c	PAR-CLIP	22012620
MIRT537420	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT537419	hsa-miR-3671	PAR-CLIP	22012620
MIRT537422	hsa-miR-5692b	PAR-CLIP	22012620
MIRT537421	hsa-miR-5692c	PAR-CLIP	22012620
MIRT537420	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT537419	hsa-miR-3671	PAR-CLIP	22012620
MIRT991524	hsa-miR-421	CLIP-seq
MIRT991525	hsa-miR-4709-5p	CLIP-seq
MIRT991526	hsa-miR-4742-5p	CLIP-seq
MIRT991527	hsa-miR-10a	CLIP-seq
MIRT991528	hsa-miR-10b	CLIP-seq
MIRT991529	hsa-miR-1197	CLIP-seq
MIRT991530	hsa-miR-1236	CLIP-seq
MIRT991531	hsa-miR-1253	CLIP-seq
MIRT991532	hsa-miR-1286	CLIP-seq
MIRT991533	hsa-miR-155	CLIP-seq
MIRT991534	hsa-miR-15a	CLIP-seq
MIRT991535	hsa-miR-15b	CLIP-seq
MIRT991536	hsa-miR-16	CLIP-seq
MIRT991537	hsa-miR-195	CLIP-seq
MIRT991538	hsa-miR-198	CLIP-seq
MIRT991539	hsa-miR-23a	CLIP-seq
MIRT991540	hsa-miR-23b	CLIP-seq
MIRT991541	hsa-miR-23c	CLIP-seq
MIRT991542	hsa-miR-297	CLIP-seq
MIRT991543	hsa-miR-3149	CLIP-seq
MIRT991544	hsa-miR-337-3p	CLIP-seq
MIRT991545	hsa-miR-3613-3p	CLIP-seq
MIRT991546	hsa-miR-361-5p	CLIP-seq
MIRT991547	hsa-miR-3714	CLIP-seq
MIRT991548	hsa-miR-374c	CLIP-seq
MIRT991549	hsa-miR-424	CLIP-seq
MIRT991550	hsa-miR-4477b	CLIP-seq
MIRT991551	hsa-miR-4494	CLIP-seq
MIRT991552	hsa-miR-4722-5p	CLIP-seq
MIRT991553	hsa-miR-4762-3p	CLIP-seq
MIRT991554	hsa-miR-4766-5p	CLIP-seq
MIRT991555	hsa-miR-497	CLIP-seq
MIRT991556	hsa-miR-499a-5p	CLIP-seq
MIRT991557	hsa-miR-545	CLIP-seq
MIRT991558	hsa-miR-548an	CLIP-seq
MIRT991559	hsa-miR-548p	CLIP-seq
MIRT991560	hsa-miR-580	CLIP-seq
MIRT991561	hsa-miR-655	CLIP-seq
MIRT991562	hsa-miR-7	CLIP-seq
MIRT1548639	hsa-miR-4659a-3p	CLIP-seq
MIRT1548640	hsa-miR-4659b-3p	CLIP-seq
MIRT1548641	hsa-miR-4661-3p	CLIP-seq
MIRT1994055	hsa-miR-1283	CLIP-seq
MIRT1994056	hsa-miR-3159	CLIP-seq
MIRT1994057	hsa-miR-3617	CLIP-seq
MIRT1994058	hsa-miR-4729	CLIP-seq
MIRT1994059	hsa-miR-579	CLIP-seq
MIRT1994060	hsa-miR-641	CLIP-seq
MIRT1994061	hsa-miR-656	CLIP-seq
MIRT2228025	hsa-let-7a	CLIP-seq
MIRT2228026	hsa-let-7b	CLIP-seq
MIRT2228027	hsa-let-7c	CLIP-seq
MIRT2228028	hsa-let-7d	CLIP-seq
MIRT2228029	hsa-let-7e	CLIP-seq
MIRT2228030	hsa-let-7f	CLIP-seq
MIRT2228031	hsa-let-7g	CLIP-seq
MIRT2228032	hsa-let-7i	CLIP-seq
MIRT2228033	hsa-miR-132	CLIP-seq
MIRT2228034	hsa-miR-212	CLIP-seq
MIRT2228035	hsa-miR-2392	CLIP-seq
MIRT1994057	hsa-miR-3617	CLIP-seq
MIRT2228036	hsa-miR-3689d	CLIP-seq
MIRT2228037	hsa-miR-3927	CLIP-seq
MIRT2228038	hsa-miR-3935	CLIP-seq
MIRT2228039	hsa-miR-3936	CLIP-seq
MIRT2228040	hsa-miR-4434	CLIP-seq
MIRT2228041	hsa-miR-4458	CLIP-seq
MIRT2228042	hsa-miR-4463	CLIP-seq
MIRT991550	hsa-miR-4477b	CLIP-seq
MIRT2228043	hsa-miR-4500	CLIP-seq
MIRT2228044	hsa-miR-4516	CLIP-seq
MIRT2228045	hsa-miR-4531	CLIP-seq
MIRT2228046	hsa-miR-4534	CLIP-seq
MIRT2228047	hsa-miR-4646-5p	CLIP-seq
MIRT1548639	hsa-miR-4659a-3p	CLIP-seq
MIRT1548640	hsa-miR-4659b-3p	CLIP-seq
MIRT2228048	hsa-miR-4688	CLIP-seq
MIRT2228049	hsa-miR-4694-3p	CLIP-seq
MIRT2228050	hsa-miR-4694-5p	CLIP-seq
MIRT2228051	hsa-miR-4768-3p	CLIP-seq
MIRT2228052	hsa-miR-499-3p	CLIP-seq
MIRT2228053	hsa-miR-499a-3p	CLIP-seq
MIRT2228054	hsa-miR-516b	CLIP-seq
MIRT2228055	hsa-miR-522	CLIP-seq
MIRT2228056	hsa-miR-584	CLIP-seq
MIRT2228057	hsa-miR-622	CLIP-seq
MIRT1994060	hsa-miR-641	CLIP-seq
MIRT1994061	hsa-miR-656	CLIP-seq
MIRT2228058	hsa-miR-98	CLIP-seq
MIRT2387928	hsa-miR-1269	CLIP-seq
MIRT2387929	hsa-miR-1269b	CLIP-seq
MIRT2387930	hsa-miR-3152-5p	CLIP-seq
MIRT2387931	hsa-miR-3664-3p	CLIP-seq
MIRT2387932	hsa-miR-4520b-3p	CLIP-seq
MIRT2387933	hsa-miR-4529-3p	CLIP-seq
MIRT1994061	hsa-miR-656	CLIP-seq
MIRT2387934	hsa-miR-873	CLIP-seq
MIRT2387935	hsa-miR-9	CLIP-seq
MIRT991533	hsa-miR-155	CLIP-seq
MIRT1994057	hsa-miR-3617	CLIP-seq
MIRT2449514	hsa-miR-4263	CLIP-seq
MIRT1994060	hsa-miR-641	CLIP-seq
MIRT2228025	hsa-let-7a	CLIP-seq
MIRT2228026	hsa-let-7b	CLIP-seq
MIRT2228027	hsa-let-7c	CLIP-seq
MIRT2228028	hsa-let-7d	CLIP-seq
MIRT2228029	hsa-let-7e	CLIP-seq
MIRT2228030	hsa-let-7f	CLIP-seq
MIRT2228031	hsa-let-7g	CLIP-seq
MIRT2228032	hsa-let-7i	CLIP-seq
MIRT2531582	hsa-miR-1183	CLIP-seq
MIRT2531583	hsa-miR-1206	CLIP-seq
MIRT2228033	hsa-miR-132	CLIP-seq
MIRT2531584	hsa-miR-142-5p	CLIP-seq
MIRT2531585	hsa-miR-203	CLIP-seq
MIRT2228034	hsa-miR-212	CLIP-seq
MIRT2531586	hsa-miR-3121-5p	CLIP-seq
MIRT2531587	hsa-miR-3143	CLIP-seq
MIRT2531588	hsa-miR-3146	CLIP-seq
MIRT1994056	hsa-miR-3159	CLIP-seq
MIRT2531589	hsa-miR-323-3p	CLIP-seq
MIRT2531590	hsa-miR-340	CLIP-seq
MIRT2531591	hsa-miR-3682-5p	CLIP-seq
MIRT2228036	hsa-miR-3689d	CLIP-seq
MIRT2531592	hsa-miR-375	CLIP-seq
MIRT2531593	hsa-miR-3908	CLIP-seq
MIRT2228037	hsa-miR-3927	CLIP-seq
MIRT2228038	hsa-miR-3935	CLIP-seq
MIRT2531594	hsa-miR-4314	CLIP-seq
MIRT2228041	hsa-miR-4458	CLIP-seq
MIRT2228043	hsa-miR-4500	CLIP-seq
MIRT1548639	hsa-miR-4659a-3p	CLIP-seq
MIRT1548640	hsa-miR-4659b-3p	CLIP-seq
MIRT2228050	hsa-miR-4694-5p	CLIP-seq
MIRT1994058	hsa-miR-4729	CLIP-seq
MIRT2531595	hsa-miR-4735-5p	CLIP-seq
MIRT2531596	hsa-miR-4742-3p	CLIP-seq
MIRT2531597	hsa-miR-4768-5p	CLIP-seq
MIRT2531598	hsa-miR-4775	CLIP-seq
MIRT2531599	hsa-miR-4778-5p	CLIP-seq
MIRT2531600	hsa-miR-487a	CLIP-seq
MIRT2228052	hsa-miR-499-3p	CLIP-seq
MIRT2228053	hsa-miR-499a-3p	CLIP-seq
MIRT2228054	hsa-miR-516b	CLIP-seq
MIRT2531601	hsa-miR-520d-5p	CLIP-seq
MIRT2531602	hsa-miR-524-5p	CLIP-seq
MIRT2531603	hsa-miR-543	CLIP-seq
MIRT2531604	hsa-miR-548a-5p	CLIP-seq
MIRT2531605	hsa-miR-548ab	CLIP-seq
MIRT2531606	hsa-miR-548ak	CLIP-seq
MIRT2531607	hsa-miR-548b-5p	CLIP-seq
MIRT2531608	hsa-miR-548c-5p	CLIP-seq
MIRT2531609	hsa-miR-548d-5p	CLIP-seq
MIRT2531610	hsa-miR-548h	CLIP-seq
MIRT2531611	hsa-miR-548i	CLIP-seq
MIRT2531612	hsa-miR-548j	CLIP-seq
MIRT2531613	hsa-miR-548n	CLIP-seq
MIRT2531614	hsa-miR-548w	CLIP-seq
MIRT2531615	hsa-miR-548y	CLIP-seq
MIRT2531616	hsa-miR-559	CLIP-seq
MIRT1994059	hsa-miR-579	CLIP-seq
MIRT2228056	hsa-miR-584	CLIP-seq
MIRT2531617	hsa-miR-590-3p	CLIP-seq
MIRT2228057	hsa-miR-622	CLIP-seq
MIRT2531618	hsa-miR-629	CLIP-seq
MIRT2531619	hsa-miR-643	CLIP-seq
MIRT2531620	hsa-miR-802	CLIP-seq
MIRT2228058	hsa-miR-98	CLIP-seq
MIRT2680879	hsa-miR-140-3p	CLIP-seq
MIRT2680880	hsa-miR-1911	CLIP-seq
MIRT2680881	hsa-miR-377	CLIP-seq
MIRT2680882	hsa-miR-4797-5p	CLIP-seq
MIRT2680883	hsa-miR-642b	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	10531037
GO:0005515	Function	Protein binding	IPI	21145461, 26496610, 27705803, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	10531035
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010830	Process	Regulation of myotube differentiation	IEA
GO:0030018	Component	Z disc	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0036211	Process	Protein modification process	TAS	10531035
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0048742	Process	Regulation of skeletal muscle fiber development	IBA
GO:0048742	Process	Regulation of skeletal muscle fiber development	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA

MIM	HGNC	e!Ensembl
609096	13593	ENSG00000167196

Q8NEZ5

Protein name

F-box only protein 22 (F-box protein FBX22p44)

Protein function

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex that is implicated in the control of various cellular processes such as cell cycle control, transcriptional regulation, DNA damage repair, and

PDB

8S7D , 8S7E , 8UA3 , 8UA6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00646	F-box	21 → 67	F-box domain	Domain
PF10442	FIST_C	278 → 365	FIST C domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in liver, also enriched in cardiac muscle. {ECO:0000269|PubMed:22972877}.

Sequence

MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVL
RTHRSVTWISAGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGH
KRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFP
QIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVV
STFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEK
TAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGN
GEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK

Sequence length

403

Interactions

View interactions

	KEGG		Reactome
	Salmonella infection		Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder	Pathogenic	rs2141698833	RCV004798925	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Tayoun-Maawali syndrome	Pathogenic	rs2141698833	RCV005401853	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31217475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29945959, 30418174, 31138683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34215846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36112263	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31217475, 31257023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35046938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30745851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	30808376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38296976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29945959, 30418174, 31138683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31217475, 31257023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29945959, 30745851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29945959, 31138683		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30887251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30745851, 30808376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30745851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36112263	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXO22 (F-box protein 22)