Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26260
Gene name	F-box protein 25
Gene symbol	FBXO25
Synonyms (NCBI Gene)	FBX25
Chromosome	8
Chromosome location	8p23.3
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Show/Hide all (69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024524	hsa-miR-215-5p	Microarray	19074876
MIRT026896	hsa-miR-192-5p	Microarray	19074876
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT685428	hsa-miR-3675-3p	HITS-CLIP	23313552
MIRT685427	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT685426	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649088	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT649086	hsa-miR-6723-5p	HITS-CLIP	23824327
MIRT649085	hsa-miR-4540	HITS-CLIP	23824327
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649088	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT649087	hsa-miR-4656	HITS-CLIP	23824327
MIRT649086	hsa-miR-6723-5p	HITS-CLIP	23824327
MIRT649085	hsa-miR-4540	HITS-CLIP	23824327
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT685428	hsa-miR-3675-3p	HITS-CLIP	23313552
MIRT685427	hsa-miR-3613-3p	HITS-CLIP	23313552
MIRT685426	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649088	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT649086	hsa-miR-6723-5p	HITS-CLIP	23824327
MIRT649085	hsa-miR-4540	HITS-CLIP	23824327
MIRT649089	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT649088	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT649087	hsa-miR-4656	HITS-CLIP	23824327
MIRT649086	hsa-miR-6723-5p	HITS-CLIP	23824327
MIRT649085	hsa-miR-4540	HITS-CLIP	23824327
MIRT991563	hsa-miR-1287	CLIP-seq
MIRT991564	hsa-miR-1914	CLIP-seq
MIRT991565	hsa-miR-1915	CLIP-seq
MIRT991566	hsa-miR-3135b	CLIP-seq
MIRT991567	hsa-miR-3154	CLIP-seq
MIRT991568	hsa-miR-3160-5p	CLIP-seq
MIRT991569	hsa-miR-3189-3p	CLIP-seq
MIRT991570	hsa-miR-345	CLIP-seq
MIRT991571	hsa-miR-3647-3p	CLIP-seq
MIRT991572	hsa-miR-4276	CLIP-seq
MIRT991573	hsa-miR-4277	CLIP-seq
MIRT991574	hsa-miR-4436b-3p	CLIP-seq
MIRT991575	hsa-miR-4722-3p	CLIP-seq
MIRT991576	hsa-miR-4726-3p	CLIP-seq
MIRT991577	hsa-miR-4757-5p	CLIP-seq
MIRT991578	hsa-miR-502-5p	CLIP-seq
MIRT991579	hsa-miR-649	CLIP-seq
MIRT991565	hsa-miR-1915	CLIP-seq
MIRT1994075	hsa-miR-23a	CLIP-seq
MIRT1994076	hsa-miR-23b	CLIP-seq
MIRT1994077	hsa-miR-23c	CLIP-seq
MIRT991567	hsa-miR-3154	CLIP-seq
MIRT991568	hsa-miR-3160-5p	CLIP-seq
MIRT1994078	hsa-miR-3976	CLIP-seq
MIRT1994079	hsa-miR-4272	CLIP-seq
MIRT991572	hsa-miR-4276	CLIP-seq
MIRT991573	hsa-miR-4277	CLIP-seq
MIRT1994080	hsa-miR-4282	CLIP-seq
MIRT991574	hsa-miR-4436b-3p	CLIP-seq
MIRT991576	hsa-miR-4726-3p	CLIP-seq
MIRT1994081	hsa-miR-513a-3p	CLIP-seq
MIRT1994075	hsa-miR-23a	CLIP-seq
MIRT1994076	hsa-miR-23b	CLIP-seq
MIRT1994077	hsa-miR-23c	CLIP-seq
MIRT1994080	hsa-miR-4282	CLIP-seq
MIRT2228059	hsa-miR-4517	CLIP-seq
MIRT1994081	hsa-miR-513a-3p	CLIP-seq
MIRT2228060	hsa-miR-889	CLIP-seq
MIRT2531621	hsa-miR-214	CLIP-seq
MIRT2531622	hsa-miR-3619-5p	CLIP-seq
MIRT2531623	hsa-miR-761	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	10531035
GO:0003779	Function	Actin binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	NAS	10531035
GO:0005515	Function	Protein binding	IPI	20473970, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16278047
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005730	Component	Nucleolus	IDA	16278047
GO:0005737	Component	Cytoplasm	IBA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0016567	Process	Protein ubiquitination	NAS	10531035
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0019005	Component	SCF ubiquitin ligase complex	ISS

MIM	HGNC	e!Ensembl
609098	13596	ENSG00000147364

Q8TCJ0

Protein name

F-box only protein 25

Protein function

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT) (By similarity).

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in all brain tissue observed. {ECO:0000269|PubMed:16278047}.

Sequence

MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEH
EYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIR
RFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNIL
YRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMY
FALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQH
FIDLFKF

Sequence length

367

Interactions

View interactions

	KEGG
	FoxO signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	27596142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16714087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16714087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	33925474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25987131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27596142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27596142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	25419709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	GWASCAT_DG	29273593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya disease 1	Moyamoya disease	GWASCAT_DG	29273593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25419709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40117808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXO25 (F-box protein 25)