Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26253
Gene name	C-type lectin domain family 4 member E
Gene symbol	CLEC4E
Synonyms (NCBI Gene)	CLECSF9MINCLE
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles

201

Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT518202	hsa-miR-5692a	PAR-CLIP	23446348
MIRT518201	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT518200	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT518199	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT518198	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT518196	hsa-miR-378g	PAR-CLIP	23446348
MIRT518197	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT518195	hsa-miR-27a-5p	PAR-CLIP	23446348
MIRT518194	hsa-miR-374c-5p	PAR-CLIP	23446348
MIRT518193	hsa-miR-655-3p	PAR-CLIP	23446348
MIRT518192	hsa-miR-1262	PAR-CLIP	23446348
MIRT518191	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT518189	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT518190	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT518202	hsa-miR-5692a	PAR-CLIP	23446348
MIRT518201	hsa-miR-3529-3p	PAR-CLIP	23446348
MIRT518200	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT518199	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT518198	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT518196	hsa-miR-378g	PAR-CLIP	23446348
MIRT518197	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT518195	hsa-miR-27a-5p	PAR-CLIP	23446348
MIRT518194	hsa-miR-374c-5p	PAR-CLIP	23446348
MIRT518193	hsa-miR-655-3p	PAR-CLIP	23446348
MIRT518192	hsa-miR-1262	PAR-CLIP	23446348
MIRT518191	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT518189	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT518190	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT896054	hsa-miR-103a	CLIP-seq
MIRT896055	hsa-miR-107	CLIP-seq
MIRT896056	hsa-miR-1206	CLIP-seq
MIRT896057	hsa-miR-1270	CLIP-seq
MIRT896058	hsa-miR-1276	CLIP-seq
MIRT896059	hsa-miR-1289	CLIP-seq
MIRT896060	hsa-miR-1301	CLIP-seq
MIRT896061	hsa-miR-143	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT896065	hsa-miR-3141	CLIP-seq
MIRT896066	hsa-miR-3154	CLIP-seq
MIRT896067	hsa-miR-3160-3p	CLIP-seq
MIRT896068	hsa-miR-3198	CLIP-seq
MIRT896069	hsa-miR-338-5p	CLIP-seq
MIRT896070	hsa-miR-3616-3p	CLIP-seq
MIRT896071	hsa-miR-3622a-5p	CLIP-seq
MIRT896072	hsa-miR-3622b-5p	CLIP-seq
MIRT896073	hsa-miR-3652	CLIP-seq
MIRT896074	hsa-miR-374c	CLIP-seq
MIRT896075	hsa-miR-3909	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT896077	hsa-miR-4294	CLIP-seq
MIRT896078	hsa-miR-4309	CLIP-seq
MIRT896079	hsa-miR-4311	CLIP-seq
MIRT896080	hsa-miR-4317	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT896082	hsa-miR-4423-3p	CLIP-seq
MIRT896083	hsa-miR-4430	CLIP-seq
MIRT896084	hsa-miR-4505	CLIP-seq
MIRT896085	hsa-miR-4633-3p	CLIP-seq
MIRT896086	hsa-miR-4643	CLIP-seq
MIRT896087	hsa-miR-4683	CLIP-seq
MIRT896088	hsa-miR-4720-5p	CLIP-seq
MIRT896089	hsa-miR-4721	CLIP-seq
MIRT896090	hsa-miR-4770	CLIP-seq
MIRT896091	hsa-miR-4790-5p	CLIP-seq
MIRT896092	hsa-miR-4799-3p	CLIP-seq
MIRT896093	hsa-miR-5047	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT896096	hsa-miR-513b	CLIP-seq
MIRT896097	hsa-miR-548p	CLIP-seq
MIRT896098	hsa-miR-548u	CLIP-seq
MIRT896099	hsa-miR-583	CLIP-seq
MIRT896100	hsa-miR-619	CLIP-seq
MIRT896101	hsa-miR-620	CLIP-seq
MIRT896102	hsa-miR-642b	CLIP-seq
MIRT896103	hsa-miR-655	CLIP-seq
MIRT896104	hsa-miR-934	CLIP-seq
MIRT896054	hsa-miR-103a	CLIP-seq
MIRT896055	hsa-miR-107	CLIP-seq
MIRT896056	hsa-miR-1206	CLIP-seq
MIRT896060	hsa-miR-1301	CLIP-seq
MIRT1965655	hsa-miR-196a	CLIP-seq
MIRT1965656	hsa-miR-196b	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT1965657	hsa-miR-219-2-3p	CLIP-seq
MIRT1965658	hsa-miR-2964a-3p	CLIP-seq
MIRT1965659	hsa-miR-302f	CLIP-seq
MIRT1965660	hsa-miR-3606	CLIP-seq
MIRT1965661	hsa-miR-3646	CLIP-seq
MIRT896075	hsa-miR-3909	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT1965662	hsa-miR-4300	CLIP-seq
MIRT896080	hsa-miR-4317	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT1965663	hsa-miR-4528	CLIP-seq
MIRT896085	hsa-miR-4633-3p	CLIP-seq
MIRT896086	hsa-miR-4643	CLIP-seq
MIRT1965664	hsa-miR-4789-5p	CLIP-seq
MIRT896093	hsa-miR-5047	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT896096	hsa-miR-513b	CLIP-seq
MIRT896098	hsa-miR-548u	CLIP-seq
MIRT1965665	hsa-miR-550b	CLIP-seq
MIRT1965666	hsa-miR-610	CLIP-seq
MIRT896100	hsa-miR-619	CLIP-seq
MIRT896102	hsa-miR-642b	CLIP-seq
MIRT1965667	hsa-miR-920	CLIP-seq
MIRT896054	hsa-miR-103a	CLIP-seq
MIRT896055	hsa-miR-107	CLIP-seq
MIRT896056	hsa-miR-1206	CLIP-seq
MIRT2201603	hsa-miR-1272	CLIP-seq
MIRT896060	hsa-miR-1301	CLIP-seq
MIRT1965655	hsa-miR-196a	CLIP-seq
MIRT1965656	hsa-miR-196b	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT1965657	hsa-miR-219-2-3p	CLIP-seq
MIRT1965658	hsa-miR-2964a-3p	CLIP-seq
MIRT1965659	hsa-miR-302f	CLIP-seq
MIRT2201604	hsa-miR-3065-5p	CLIP-seq
MIRT2201605	hsa-miR-3163	CLIP-seq
MIRT1965660	hsa-miR-3606	CLIP-seq
MIRT1965661	hsa-miR-3646	CLIP-seq
MIRT896075	hsa-miR-3909	CLIP-seq
MIRT2201606	hsa-miR-410	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT1965662	hsa-miR-4300	CLIP-seq
MIRT896080	hsa-miR-4317	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT896085	hsa-miR-4633-3p	CLIP-seq
MIRT896086	hsa-miR-4643	CLIP-seq
MIRT2201607	hsa-miR-4802-3p	CLIP-seq
MIRT2201608	hsa-miR-495	CLIP-seq
MIRT896093	hsa-miR-5047	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT896096	hsa-miR-513b	CLIP-seq
MIRT2201609	hsa-miR-548aa	CLIP-seq
MIRT896097	hsa-miR-548p	CLIP-seq
MIRT896098	hsa-miR-548u	CLIP-seq
MIRT1965666	hsa-miR-610	CLIP-seq
MIRT896102	hsa-miR-642b	CLIP-seq
MIRT1965667	hsa-miR-920	CLIP-seq
MIRT896054	hsa-miR-103a	CLIP-seq
MIRT896055	hsa-miR-107	CLIP-seq
MIRT896056	hsa-miR-1206	CLIP-seq
MIRT2386171	hsa-miR-1292	CLIP-seq
MIRT896060	hsa-miR-1301	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT896075	hsa-miR-3909	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT896080	hsa-miR-4317	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT2386172	hsa-miR-4471	CLIP-seq
MIRT896093	hsa-miR-5047	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT896096	hsa-miR-513b	CLIP-seq
MIRT896097	hsa-miR-548p	CLIP-seq
MIRT2386171	hsa-miR-1292	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT2386172	hsa-miR-4471	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT2201609	hsa-miR-548aa	CLIP-seq
MIRT2386171	hsa-miR-1292	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT2386172	hsa-miR-4471	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT2201609	hsa-miR-548aa	CLIP-seq
MIRT2386171	hsa-miR-1292	CLIP-seq
MIRT896062	hsa-miR-200b	CLIP-seq
MIRT896063	hsa-miR-200c	CLIP-seq
MIRT896064	hsa-miR-217	CLIP-seq
MIRT2201604	hsa-miR-3065-5p	CLIP-seq
MIRT2201605	hsa-miR-3163	CLIP-seq
MIRT2201606	hsa-miR-410	CLIP-seq
MIRT896076	hsa-miR-429	CLIP-seq
MIRT896081	hsa-miR-4418	CLIP-seq
MIRT2386172	hsa-miR-4471	CLIP-seq
MIRT2201608	hsa-miR-495	CLIP-seq
MIRT896094	hsa-miR-509-3-5p	CLIP-seq
MIRT896095	hsa-miR-509-5p	CLIP-seq
MIRT2201609	hsa-miR-548aa	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001891	Component	Phagocytic cup	IEA
GO:0002221	Process	Pattern recognition receptor signaling pathway	IMP	24101491
GO:0002292	Process	T cell differentiation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002764	Process	Immune response-regulating signaling pathway	IEA
GO:0005509	Function	Calcium ion binding	IDA	24101491
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IDA	24101491
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	10528209
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	ISS
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IEA
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0038187	Function	Pattern recognition receptor activity	IDA	24101491
GO:0038187	Function	Pattern recognition receptor activity	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051861	Function	Glycolipid binding	IEA
GO:0051861	Function	Glycolipid binding	ISS
GO:0061760	Process	Antifungal innate immune response	IBA
GO:0061760	Process	Antifungal innate immune response	IEA
GO:0061760	Process	Antifungal innate immune response	ISS

MIM	HGNC	e!Ensembl
609962	14555	ENSG00000166523

Q9ULY5

Protein name

C-type lectin domain family 4 member E (C-type lectin superfamily member 9) (Macrophage-inducible C-type lectin) (MINCLE)

Protein function

Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and f

PDB

3WH2 , 3WH3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	97 → 207	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in monocytes and macrophages. {ECO:0000269|PubMed:23602766}.

Sequence

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Sequence length

219

Interactions

View interactions

	KEGG		Reactome
	C-type lectin receptor signaling pathway Tuberculosis		Dectin-2 family

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	27587433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	22932191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17082220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30102794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27587433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31725411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27845194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36329882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28141595, 28888778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28017324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28202166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	21602193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	22479529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27845194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31725411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30353660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31863085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22932191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27845194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36131933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30353660		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLEC4E (C-type lectin domain family 4 member E)