GATA3 (GATA binding protein 3)

Gene

• Entrez ID: 2625
• Gene name: GATA binding protein 3
• Gene symbol: GATA3
• Synonyms (NCBI Gene): HDR, HDRS
• Chromosome: 10
• Chromosome location: 10p14
• Summary: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894162	C>T	Pathogenic	Stop gained, coding sequence variant
rs104894163	T>A	Pathogenic	Missense variant, coding sequence variant
rs104894164	C>T	Pathogenic	Stop gained, coding sequence variant
rs104894165	A>G,T	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs112417755	G>C,T	Pathogenic	Splice acceptor variant
rs387906551	T>GCTTACTTCCC	Pathogenic	Splice donor variant
rs387906621	G>A	Pathogenic	Coding sequence variant, missense variant
rs767074039	T>C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307641	AT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1564405153	A>-,AA	Likely-pathogenic, uncertain-significance	Frameshift variant, coding sequence variant
rs1564405163	G>A,C	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1588383622	G>A	Pathogenic	Missense variant, coding sequence variant
rs1588391546	->AAAAAGTGCA	Likely-pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021783	hsa-miR-132-3p	Microarray	17612493
MIRT024016	hsa-miR-1-3p	Microarray	18668037
MIRT049754	hsa-miR-92a-3p	CLASH	23622248
MIRT438911	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438911	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT057215	hsa-miR-10b-5p	3'LIFE	25074381
MIRT057215	hsa-miR-10b-5p	3'LIFE	25074381
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT731292	hsa-miR-27a-3p	Luciferase reporter assay	26834155
MIRT737216	hsa-miR-455-3p	Luciferase reporter assay, Immunoprecipitaion (IP), qRT-PCR	31492753
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012509	hsa-miR-1204	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012512	hsa-miR-1252	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012524	hsa-miR-141	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012528	hsa-miR-150	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012530	hsa-miR-1827	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012533	hsa-miR-200a	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012549	hsa-miR-3148	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012557	hsa-miR-3613-3p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012561	hsa-miR-3688-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012563	hsa-miR-3692	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012571	hsa-miR-3921	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012590	hsa-miR-4461	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012594	hsa-miR-4494	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012602	hsa-miR-4632	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012605	hsa-miR-4653-5p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012609	hsa-miR-4694-3p	CLIP-seq
MIRT1012610	hsa-miR-4698	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012613	hsa-miR-4713-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012620	hsa-miR-4766-5p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012630	hsa-miR-494	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012643	hsa-miR-532-3p	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012659	hsa-miR-656	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012512	hsa-miR-1252	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012664	hsa-miR-1288	CLIP-seq
MIRT1012665	hsa-miR-1291	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012524	hsa-miR-141	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012666	hsa-miR-146b-3p	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012528	hsa-miR-150	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012667	hsa-miR-1909	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012668	hsa-miR-1976	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012533	hsa-miR-200a	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012669	hsa-miR-3065-3p	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012670	hsa-miR-3199	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012563	hsa-miR-3692	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012671	hsa-miR-4268	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012672	hsa-miR-4418	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012590	hsa-miR-4461	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012674	hsa-miR-4475	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012675	hsa-miR-4488	CLIP-seq
MIRT1012594	hsa-miR-4494	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012676	hsa-miR-4677-3p	CLIP-seq
MIRT1012677	hsa-miR-4697-5p	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012613	hsa-miR-4713-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012678	hsa-miR-4731-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012679	hsa-miR-485-3p	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012680	hsa-miR-509-3-5p	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012681	hsa-miR-509-5p	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012643	hsa-miR-532-3p	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012682	hsa-miR-637	CLIP-seq
MIRT1012659	hsa-miR-656	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012683	hsa-miR-720	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012506	hsa-miR-101	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012511	hsa-miR-1245b-5p	CLIP-seq
MIRT1012513	hsa-miR-1272	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012515	hsa-miR-128	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012664	hsa-miR-1288	CLIP-seq
MIRT1012517	hsa-miR-1295	CLIP-seq
MIRT1012518	hsa-miR-1322	CLIP-seq
MIRT1012519	hsa-miR-1323	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012522	hsa-miR-140-3p	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012525	hsa-miR-142-5p	CLIP-seq
MIRT1012526	hsa-miR-144	CLIP-seq
MIRT1012527	hsa-miR-1470	CLIP-seq
MIRT1012529	hsa-miR-155	CLIP-seq
MIRT1012530	hsa-miR-1827	CLIP-seq
MIRT1012667	hsa-miR-1909	CLIP-seq
MIRT1012531	hsa-miR-1912	CLIP-seq
MIRT1012668	hsa-miR-1976	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012534	hsa-miR-205	CLIP-seq
MIRT1012535	hsa-miR-208a	CLIP-seq
MIRT1012536	hsa-miR-208b	CLIP-seq
MIRT1012537	hsa-miR-2116	CLIP-seq
MIRT1012538	hsa-miR-2355-3p	CLIP-seq
MIRT1012539	hsa-miR-2467-3p	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012543	hsa-miR-300	CLIP-seq
MIRT1012669	hsa-miR-3065-3p	CLIP-seq
MIRT1012544	hsa-miR-3074-3p	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012546	hsa-miR-3121-5p	CLIP-seq
MIRT1012547	hsa-miR-3130-5p	CLIP-seq
MIRT1012548	hsa-miR-3142	CLIP-seq
MIRT1012549	hsa-miR-3148	CLIP-seq
MIRT1012550	hsa-miR-3160-5p	CLIP-seq
MIRT1012670	hsa-miR-3199	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012552	hsa-miR-330-3p	CLIP-seq
MIRT1012553	hsa-miR-338-5p	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012557	hsa-miR-3613-3p	CLIP-seq
MIRT1012558	hsa-miR-361-5p	CLIP-seq
MIRT1012559	hsa-miR-3670	CLIP-seq
MIRT1012560	hsa-miR-3678-3p	CLIP-seq
MIRT1012561	hsa-miR-3688-3p	CLIP-seq
MIRT1012562	hsa-miR-3688-5p	CLIP-seq
MIRT1012564	hsa-miR-369-3p	CLIP-seq
MIRT1012566	hsa-miR-374a	CLIP-seq
MIRT1012567	hsa-miR-374b	CLIP-seq
MIRT1012568	hsa-miR-380	CLIP-seq
MIRT1012569	hsa-miR-381	CLIP-seq
MIRT1012570	hsa-miR-3907	CLIP-seq
MIRT1012571	hsa-miR-3921	CLIP-seq
MIRT1012572	hsa-miR-4261	CLIP-seq
MIRT1012671	hsa-miR-4268	CLIP-seq
MIRT1012573	hsa-miR-4272	CLIP-seq
MIRT1012574	hsa-miR-4274	CLIP-seq
MIRT1012575	hsa-miR-4275	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012577	hsa-miR-4277	CLIP-seq
MIRT1012578	hsa-miR-4289	CLIP-seq
MIRT1012579	hsa-miR-4291	CLIP-seq
MIRT1012580	hsa-miR-4297	CLIP-seq
MIRT1012581	hsa-miR-4299	CLIP-seq
MIRT1012582	hsa-miR-4310	CLIP-seq
MIRT1012583	hsa-miR-4318	CLIP-seq
MIRT1012584	hsa-miR-433	CLIP-seq
MIRT1012672	hsa-miR-4418	CLIP-seq
MIRT1012585	hsa-miR-4422	CLIP-seq
MIRT1012586	hsa-miR-4432	CLIP-seq
MIRT1012587	hsa-miR-4435	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012588	hsa-miR-4448	CLIP-seq
MIRT1012589	hsa-miR-4452	CLIP-seq
MIRT1012591	hsa-miR-4470	CLIP-seq
MIRT1012674	hsa-miR-4475	CLIP-seq
MIRT1012592	hsa-miR-4482	CLIP-seq
MIRT1012595	hsa-miR-4496	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012599	hsa-miR-450b-5p	CLIP-seq
MIRT1012600	hsa-miR-4517	CLIP-seq
MIRT1012601	hsa-miR-4519	CLIP-seq
MIRT1012602	hsa-miR-4632	CLIP-seq
MIRT1012603	hsa-miR-4642	CLIP-seq
MIRT1012604	hsa-miR-4646-3p	CLIP-seq
MIRT1012605	hsa-miR-4653-5p	CLIP-seq
MIRT1012606	hsa-miR-4659a-3p	CLIP-seq
MIRT1012607	hsa-miR-4659b-3p	CLIP-seq
MIRT1012608	hsa-miR-4666-3p	CLIP-seq
MIRT1012609	hsa-miR-4694-3p	CLIP-seq
MIRT1012610	hsa-miR-4698	CLIP-seq
MIRT1012611	hsa-miR-4709-5p	CLIP-seq
MIRT1012612	hsa-miR-4711-5p	CLIP-seq
MIRT1012614	hsa-miR-4717-5p	CLIP-seq
MIRT1012615	hsa-miR-4719	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012618	hsa-miR-4727-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012620	hsa-miR-4766-5p	CLIP-seq
MIRT1012621	hsa-miR-4774-5p	CLIP-seq
MIRT1012622	hsa-miR-4775	CLIP-seq
MIRT1012623	hsa-miR-4778-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012626	hsa-miR-4795-3p	CLIP-seq
MIRT1012627	hsa-miR-4796-3p	CLIP-seq
MIRT1012628	hsa-miR-4803	CLIP-seq
MIRT1012679	hsa-miR-485-3p	CLIP-seq
MIRT1012629	hsa-miR-488	CLIP-seq
MIRT1012631	hsa-miR-495	CLIP-seq
MIRT1012632	hsa-miR-499-5p	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012680	hsa-miR-509-3-5p	CLIP-seq
MIRT1012634	hsa-miR-5095	CLIP-seq
MIRT1012681	hsa-miR-509-5p	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012636	hsa-miR-513a-3p	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012638	hsa-miR-513b	CLIP-seq
MIRT1012639	hsa-miR-518a-5p	CLIP-seq
MIRT1012640	hsa-miR-520g	CLIP-seq
MIRT1012641	hsa-miR-520h	CLIP-seq
MIRT1012642	hsa-miR-527	CLIP-seq
MIRT1012644	hsa-miR-532-5p	CLIP-seq
MIRT1012645	hsa-miR-544	CLIP-seq
MIRT1012646	hsa-miR-548a-3p	CLIP-seq
MIRT1012647	hsa-miR-548al	CLIP-seq
MIRT1012649	hsa-miR-548e	CLIP-seq
MIRT1012650	hsa-miR-548f	CLIP-seq
MIRT1012651	hsa-miR-548o	CLIP-seq
MIRT1012652	hsa-miR-568	CLIP-seq
MIRT1012653	hsa-miR-582-3p	CLIP-seq
MIRT1012654	hsa-miR-590-3p	CLIP-seq
MIRT1012655	hsa-miR-600	CLIP-seq
MIRT1012656	hsa-miR-615-3p	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012658	hsa-miR-616	CLIP-seq
MIRT1012660	hsa-miR-663b	CLIP-seq
MIRT1012661	hsa-miR-887	CLIP-seq
MIRT1012662	hsa-miR-95	CLIP-seq
MIRT1012507	hsa-miR-10a	CLIP-seq
MIRT1012508	hsa-miR-10b	CLIP-seq
MIRT1012510	hsa-miR-1245	CLIP-seq
MIRT1012514	hsa-miR-1273g	CLIP-seq
MIRT1012520	hsa-miR-135a	CLIP-seq
MIRT1012521	hsa-miR-135b	CLIP-seq
MIRT1012523	hsa-miR-140-5p	CLIP-seq
MIRT1012532	hsa-miR-198	CLIP-seq
MIRT1012540	hsa-miR-2682	CLIP-seq
MIRT1012541	hsa-miR-27a	CLIP-seq
MIRT1012542	hsa-miR-27b	CLIP-seq
MIRT1012545	hsa-miR-3121-3p	CLIP-seq
MIRT1012551	hsa-miR-3201	CLIP-seq
MIRT1012554	hsa-miR-34a	CLIP-seq
MIRT1012555	hsa-miR-34c-3p	CLIP-seq
MIRT1012556	hsa-miR-34c-5p	CLIP-seq
MIRT1012565	hsa-miR-3714	CLIP-seq
MIRT1012576	hsa-miR-4276	CLIP-seq
MIRT1012593	hsa-miR-4484	CLIP-seq
MIRT1012596	hsa-miR-449a	CLIP-seq
MIRT1012597	hsa-miR-449b	CLIP-seq
MIRT1012598	hsa-miR-449c	CLIP-seq
MIRT1012617	hsa-miR-4725-5p	CLIP-seq
MIRT1012625	hsa-miR-4791	CLIP-seq
MIRT1012633	hsa-miR-504	CLIP-seq
MIRT1012635	hsa-miR-5096	CLIP-seq
MIRT1012637	hsa-miR-513a-5p	CLIP-seq
MIRT1012648	hsa-miR-548an	CLIP-seq
MIRT1012657	hsa-miR-615-5p	CLIP-seq
MIRT1012619	hsa-miR-4742-3p	CLIP-seq
MIRT1012624	hsa-miR-4789-5p	CLIP-seq
MIRT1012663	hsa-miR-1205	CLIP-seq
MIRT1012516	hsa-miR-1286	CLIP-seq
MIRT1012673	hsa-miR-4438	CLIP-seq
MIRT1012616	hsa-miR-4722-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA3	Unknown	20484083
MEN1	Unknown	20484083
MYB	Unknown	20484083
NFKB1	Activation	20660789
RELA	Activation	20660789
SATB1	Activation	20126258
SP1	Unknown	15486968
TBX21	Unknown	17075044
TCF7L2	Unknown	22951069

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IDA	20855495
GO:0000785	Component	Chromatin	ISA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19723756, 19735555, 19805038, 20189993, 20484083
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19674970
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	20484083
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	19232384
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19674970
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2017177
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001709	Process	Cell fate determination	IEA
GO:0001709	Process	Cell fate determination	ISS
GO:0001764	Process	Neuron migration	IEA
GO:0001775	Process	Cell activation	IEA
GO:0001806	Process	Type IV hypersensitivity	IEA
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001822	Process	Kidney development	IMP	19248180, 19723756
GO:0001823	Process	Mesonephros development	IEA
GO:0001823	Process	Mesonephros development	ISS
GO:0002088	Process	Lens development in camera-type eye	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002520	Process	Immune system development	IBA
GO:0002572	Process	Pro-T cell differentiation	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003215	Process	Cardiac right ventricle morphogenesis	IEA
GO:0003215	Process	Cardiac right ventricle morphogenesis	ISS
GO:0003281	Process	Ventricular septum development	IEA
GO:0003281	Process	Ventricular septum development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	1871134
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19232384, 19805038, 20189993
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	19674970, 20368097
GO:0003700	Function	DNA-binding transcription factor activity	TAS	2050118, 8088776
GO:0005134	Function	Interleukin-2 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	15662016, 17075044, 19674970, 19723756, 20484083, 25416956, 25910212, 26028330, 26871637, 26899996, 28263977, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19674970, 19723756, 20189993, 22529382
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	TAS	7592673
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0006959	Process	Humoral immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009615	Process	Response to virus	IEP	20583921
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10935639
GO:0009791	Process	Post-embryonic development	IEA
GO:0009967	Process	Positive regulation of signal transduction	IMP	19674970
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	19674970
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	26451614
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030217	Process	T cell differentiation	IDA	2017177
GO:0030217	Process	T cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0030856	Process	Regulation of epithelial cell differentiation	IBA
GO:0031929	Process	TOR signaling	IEA
GO:0031929	Process	TOR signaling	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	20554961
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IMP	20368097
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032754	Process	Positive regulation of interleukin-5 production	IDA	20554961
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033600	Process	Negative regulation of mammary gland epithelial cell proliferation	IDA	19483726
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IEP	20554961
GO:0035799	Process	Ureter maturation	IEA
GO:0035898	Process	Parathyroid hormone secretion	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	ISS
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043583	Process	Ear development	IMP	19248180, 19723756
GO:0043627	Process	Response to estrogen	IEP	10037815
GO:0045061	Process	Thymic T cell selection	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IDA	20484083
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045471	Process	Response to ethanol	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	ISS
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045622	Process	Regulation of T-helper cell differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	IMP	20189993
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	19674970
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	19723756, 19805038
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19674970, 20368097
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2017177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	2017177, 19232384, 20189993, 20484083
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048485	Process	Sympathetic nervous system development	ISS
GO:0048538	Process	Thymus development	IEA
GO:0048568	Process	Embryonic organ development	IBA
GO:0048568	Process	Embryonic organ development	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	ISS
GO:0048731	Process	System development	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	19674970
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0051216	Process	Cartilage development	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19674970
GO:0060017	Process	Parathyroid gland development	IEA
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060065	Process	Uterus development	IEA
GO:0060065	Process	Uterus development	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0060231	Process	Mesenchymal to epithelial transition	IDA	20189993
GO:0060374	Process	Mast cell differentiation	IEA
GO:0060676	Process	Ureteric bud formation	IEA
GO:0060676	Process	Ureteric bud formation	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15016828
GO:0070888	Function	E-box binding	IDA	20855495
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEP	20554961
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	19674970
GO:0071599	Process	Otic vesicle development	IEA
GO:0071773	Process	Cellular response to BMP stimulus	IEA
GO:0071837	Function	HMG box domain binding	IPI	18445004
GO:0072107	Process	Positive regulation of ureteric bud formation	IEA
GO:0072107	Process	Positive regulation of ureteric bud formation	ISS
GO:0072178	Process	Nephric duct morphogenesis	IEA
GO:0072178	Process	Nephric duct morphogenesis	ISS
GO:0072179	Process	Nephric duct formation	IEA
GO:0072179	Process	Nephric duct formation	ISS
GO:0072182	Process	Regulation of nephron tubule epithelial cell differentiation	IEA
GO:0072182	Process	Regulation of nephron tubule epithelial cell differentiation	ISS
GO:0072197	Process	Ureter morphogenesis	IEA
GO:0072676	Process	Lymphocyte migration	IDA	19805038
GO:0090102	Process	Cochlea development	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26451614
GO:1990226	Function	Histone methyltransferase binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000146	Process	Negative regulation of cell motility	IMP	20189993
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	19674970
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	IEA
GO:2000607	Process	Negative regulation of cell proliferation involved in mesonephros development	IEA
GO:2000607	Process	Negative regulation of cell proliferation involved in mesonephros development	ISS
GO:2000611	Process	Positive regulation of thyroid hormone generation	IMP	19248180, 19723756
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IMP	20368097
GO:2000683	Process	Regulation of cellular response to X-ray	IMP	19735555
GO:2000703	Process	Negative regulation of fibroblast growth factor receptor signaling pathway involved in ureteric bud formation	IEA
GO:2000703	Process	Negative regulation of fibroblast growth factor receptor signaling pathway involved in ureteric bud formation	ISS
GO:2000734	Process	Negative regulation of glial cell-derived neurotrophic factor receptor signaling pathway involved in ureteric bud formation	IEA
GO:2000734	Process	Negative regulation of glial cell-derived neurotrophic factor receptor signaling pathway involved in ureteric bud formation	ISS

Other IDs

• MIM: 131320
• HGNC: 4172
• e!Ensembl: ENSG00000107485

Protein

• UniProt ID: P23771
• Protein name: Trans-acting T-cell-specific transcription factor GATA-3 (GATA-binding factor 3)
• Protein function: Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory respons
• PDB: 4HC7, 4HC9, 4HCA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00320	GATA	263 → 297	GATA zinc finger	Domain
  PF00320	GATA	317 → 351	GATA zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: T-cells and endothelial cells.
• Sequence:

  MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
  PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
  SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
  KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL
  GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL
  IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG
  IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT
  PMHPPSSLSFGPHHPSSMVTAMG

• Sequence length: 443

Pathways

KEGG:

Th1 and Th2 cell differentiation
Th17 cell differentiation
Parathyroid hormone synthesis, secretion and action
Inflammatory bowel disease

Reactome:

Ub-specific processing proteases
Interleukin-4 and Interleukin-13 signaling
RUNX1 regulates transcription of genes involved in differentiation of HSCs
Estrogen-dependent gene expression
Factors involved in megakaryocyte development and platelet production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Congenital anomaly of kidney and urinary tract	Likely pathogenic	rs1832899364	RCV001328306	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deafness, autosomal dominant	Pathogenic	rs2491461355	RCV003155569	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cancer of breast	Pathogenic	rs763236375, rs112417755	RCV005869746 RCV005899790	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GATA3-related disorder	Pathogenic; Likely pathogenic	rs772396478, rs2491461857, rs112417755, rs1588377948	RCV004731212 RCV003982547 RCV004730959 RCV003892163	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing impairment	Likely pathogenic	rs2131482893	RCV001375170	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoparathyroidism, deafness, renal disease syndrome	Pathogenic; Likely pathogenic	rs2131488953, rs746122348, rs2131511714, rs2131491404, rs763575837, rs2131488650, rs2131500277, rs772396478, rs1832899364, rs766098800, rs2131488863, rs763236375, rs111283999, rs2131501118, rs878853222, rs2491460705, rs2491464754, rs2491462423, rs2131511647, rs104894163, rs2131501178, rs104894164, rs1588377948, rs1588378126, rs387906551, rs104894165, rs2131500548, rs2131500836, rs2491485930, rs2491466419, rs1588374920, rs387906621, rs1085307641, rs1564405163, rs1832680700, rs771019738, rs1832898282, rs1832698457, rs767074039	RCV001375869 RCV001527690 RCV001527691 RCV001799520 RCV001822880 RCV001823288 RCV001783345 RCV002051993 RCV003155447 RCV005235638 RCV002250007 RCV002250008 RCV002471647 RCV005227806 RCV005869989 RCV000225007 RCV003238173 RCV003333552 RCV000018100 RCV000018101 RCV000018103 RCV000018104 RCV000018105 RCV000018106 RCV000018107 RCV000018108 RCV000018109 RCV003985126 RCV003991235 RCV004584162 RCV004593582 RCV000022538 RCV000022539 RCV005252919 RCV000709930 RCV001078192 RCV000988325 RCV001089562 RCV001089964 RCV001197241 RCV001251506 RCV001254692	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Monogenic hearing loss	Pathogenic	rs763575837	RCV006254280	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Likely pathogenic; Pathogenic	rs2131501111, rs763236375	RCV004671616 RCV005232920	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Stage 5 chronic kidney disease	Pathogenic	rs112417755	RCV000494924	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-cell childhood acute lymphoblastic leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH HYPERDIPLOIDY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARAKAT SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAKUT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOGENESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE STAGE 5	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dominant congenital non-syndromic sensorineural hearing loss	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRO-ENTEROPANCREATIC NEUROENDOCRINE TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL CAVITY POLYP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian neoplasm	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SELECTIVE IGA DEFICIENCY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	28551327		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27684731, 28415601, 28566565, 29434778, 30859636, 31519704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27338760, 28461097, 28693610, 29851704, 30059453		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	24743840		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27568346, 28322854, 29299165, 29453984, 30093726, 30628926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	24578300, 28316088		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28374498		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28374498		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27684731, 28415601		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15632006, 18430472, 20660789, 21037568, 26473286, 28877074		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	CTD_human_DG	21037568		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10826901		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	19897590		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	10856149, 17620074, 18037162, 18607915, 22487280, 28401852, 28802126, 31081939, 31812574		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	26551570		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	26551570		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	15526312		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	17654061, 37980558	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	35437049	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	30782609		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27082299, 30474833		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	LHGDN	17654061		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29710551		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29097726, 29854762		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	31238969	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	31238969	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32831971	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12900517, 15637551, 15947486, 16364194, 16498264, 16874300, 17878900, 18537589, 19038437, 21537830, 23786933, 24153332, 24363163, 24785327, 25738969, 27910098, 28756630, 28974953, 29115454, 29498435, 29768397, 29914889, 30233198, 30896504, 31090575, 9949310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	28598986, 30552067, 36634709, 38346176	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	28756630	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30552067, 30929738, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atresia of vagina	Atresia Of Vagina	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	24596378		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	28119269, 30662663		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30254507		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29514917, 30379806		★☆☆☆☆ Found in Text Mining only
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	BEFREE	10935639, 11389161, 11577985, 12110949, 14985365, 15361840, 15705923, 15830275, 16509533, 17210674, 19022243, 19248180, 19723756, 19952462, 20425828, 21120445, 21157112, 21242646, 21399899, 23186964, 23666531, 23720234, 23757620, 24434941, 25124981, 25510779, 25771973, 25917456, 26268891, 26514990, 26731259, 26777049, 29073906, 30061207, 30218523, 31069810, 31660939		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	ORPHANET_DG	10935639, 21120445, 23757620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	UNIPROT_DG	10935639, 11389161, 26514990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	CLINGEN_DG	10935639, 11389161, 21120445, 23666531, 25771973, 25917456, 26316437, 27387476, 30396722, 31069810, 7550312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Barakat syndrome	Pubtator	11389161, 21157112, 21242646, 23435732, 25510779, 26216189, 26268891, 26514990, 26731259, 26777049, 26800885, 28303854, 28566604, 29073906, 30218523, 31660939, 32155322, 33159669, 34815386, 37600721	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	CTD_human_DG	20006695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	GENOMICS_ENGLAND_DG	21834031, 9949310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	25873156, 28969068, 29631029		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28656603		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	26800885	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28029429		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24448324, 27237631, 27612592, 27924948, 28765327, 29524970		★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	30613307	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29170477		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	33307492	Associate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	27338760		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10096242, 16357129, 17078870, 18006915, 18268121, 18544966, 19082709, 19405945, 19435916, 19483726, 19638208, 19728080, 19946260, 20189993, 20501593, 21761347, 23354167, 23430443, 23733266, 23851505, 24043118, 24205108, 24477928, 24713735, 24758297, 25410484, 25479686, 25713166, 25994056, 26028330, 26313026, 26317312, 26486740, 26657142, 26922637, 27338760, 27556158, 27588951, 27633145, 27654269, 27867016, 28038704, 28211079, 28215639, 28288473, 28394898, 28405154, 28423734, 28428285, 28470571, 28581515, 28693610, 28700933, 28703335, 28722108, 28805661, 28965624, 29340880, 29408697, 29431200, 29510139, 29535312, 29662164, 29902578, 29972720, 30061207, 30100605, 30125424, 30149959, 30293951, 30354850, 30389437, 30468800, 30562218, 30872657, 30928413, 31107186, 31218575, 31409898, 31424658, 31492753, 31685800, 31718619, 31754326		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	33462316, 34261476	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17078870, 19082709, 19084267, 19405945, 19549328, 19638208, 20068169, 20103682, 20130088, 20132413, 20173733, 20501593, 21078439, 21329183, 21878914, 22722202, 22767585, 23000897, 23172872, 23375642, 23435732, 23604756, 23723241, 24043118, 24145643, 24194916, 24205108, 24235142, 24477928, 24549642, 24711443, 24758297, 24811890, 25410484, 25652398, 25850943, 25994056, 26465236, 26467651, 26510790, 26595821, 26657142, 26922637, 26960396, 27018307, 27283966, 27556158, 27588951, 27809618, 27925203, 27997592, 28027327, 28423734, 28514748, 28693610, 28805661, 29235613, 29434343, 29662164, 30327465, 30613307, 30649385, 30811755, 30883028, 30928413, 31409898, 31424658, 31575382, 31718619, 31801599, 31911546, 31932411, 32067942, 32114594, 32164620, 32232341, 32241303, 32255732, 32429656, 32461377, 32538432, 32587399, 32938228, 33011748, 33274848, 33298139, 33382535, 33462316, 33902008, 34057115, 34261476, 34358678, 34779146, 34815386, 34836952, 34972751, 34975314, 35101884, 35331302, 35388661, 36252018, 36404592, 36805183, 36853299, 36856111, 36856112, 36996051, 37074839, 37077069, 37230023, 37454130, 37461248, 37667882, 38403109, 38523186, 39208653, 40439821, 40479714, 40585280	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19435916, 24448324, 27654269, 31685800	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24887547, 30872657, 32687248	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	24194916, 26960396, 29116378, 31340200, 33964913, 38369186	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG	23996088, 24141364, 24203929		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	24429398	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcium Metabolism Disorders	Calcium metabolism disorders	Pubtator	25165186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12057898, 23577196	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	25410484, 37667882	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	16357129, 17460449, 24713735, 25257949, 26317312, 26486740, 28038704, 28211079, 28215639, 28338653, 28374498, 28428285, 28470571, 28614203, 29340880, 29434343, 29851704, 30059453, 30148742, 30293951, 30390035, 31494492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	26595821	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	31222589	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	24145643, 25855136, 26595821, 28470571	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23375642	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24145643	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25552913, 27458175, 27528231, 31419443, 31871924, 35349565	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21078439	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	28693610, 29654370, 33650041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	12057898		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	24596378	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26249178, 33795819, 38523186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	26451490, 27642214, 35477749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	26595821	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24448324, 27237631, 27612592, 27924948, 28765327, 29524970		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11869475, 22797725, 29340880, 30093726, 30389437		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	29116378, 31340200		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18769122, 31636361, 36961416	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20208565, 20502531, 24549248, 27031776, 33501493, 35980471, 39258829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24145643	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12057898, 36323682	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23106579, 26297502, 34301206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	34784541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25855136		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	BEFREE	29431200		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	29851704		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	30148742		★☆☆☆☆ Found in Text Mining only
Cataract congenital with microcornea or slight microphthalmia	Cataract-microcornea syndrome	Pubtator	29073906	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	15247173		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31129437		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18217980, 28214368, 28940520, 31238167		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	12057898		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18217980, 28214368, 28940520, 31238167		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24141364, 27684731, 28415601		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31033498		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 2	Kidney Disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29434778		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	28490401, 31326962		★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	BEFREE	28705707		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27556823		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25112700, 27639807		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22467146, 25526479	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	24743840		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31204011, 31666198		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	24743840		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24743840, 28675510, 30658502, 37939965	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30193889		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32575504	Associate	★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	BEFREE	16509533, 31069810		★☆☆☆☆ Found in Text Mining only
Congenital duplication of uterus	Congenital Duplication Of Uterus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of kidney	Renal hypoplasia	BEFREE	21399899		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	26731259		★☆☆☆☆ Found in Text Mining only
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	26731259		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20208565, 28374498, 31636361, 31690668		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24753507		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	36889300	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22467146	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27639807		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	26731259, 37600721	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	24192446	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	29466722		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	27595298		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15057031, 26999588, 27992853, 28949314, 29053977, 29117870, 29235396, 30443924, 30637889, 30670990, 30997716, 31147243, 31415914		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	31431611	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21537830, 22112437		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15008986	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	18410415	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28928464	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15008986, 18410415, 21537830, 22112437, 28928464		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18410415		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21611195, 28928464		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15526312, 28765956		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15526312, 19952462, 28765956		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	17244154	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35966054, 35986039	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30044774	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17244154, 28765956		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	31152121		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30044774		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35909542	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28877074		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	21242646		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	21242646	Associate	★☆☆☆☆ Found in Text Mining only
Distal Renal Tubular Acidosis	Distal Renal Tubular Acidosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	24205108, 24578300		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28364022		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15008986, 18410415, 21537830, 28928464		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	18410415, 28598986	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	36518248	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30059453		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35533253	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22356900		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	17878900, 28401852, 29615049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	CTD_human_DG	27315767		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia, Tropical	Eosinophilia	CTD_human_DG	27315767		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29374572	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	32833315	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	39907396	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	7902061		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25144454	Stimulate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	31708666		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	26595821	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21423196, 22987153		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21423196, 22987153		★☆☆☆☆ Found in Text Mining only
Female Urogenital Diseases	Female infertility	Pubtator	21157112	Associate	★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	33382535	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24504018		★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	CTD_human_DG	29915428		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	29374572	Associate	★☆☆☆☆ Found in Text Mining only
Genitourinary Neoplasms	Genitourinary Neoplasms	BEFREE	17460449		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28614770, 30868892		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28614770, 31075138, 40333895	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28614770, 30868892		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29617666	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28566604	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30291167		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22014209		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	22014209	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	22014209		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	28690889	Stimulate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	24622013, 28303854, 29073906	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	21157112, 24622013, 26216189, 26514990, 26800885, 28303854, 29073906, 29986705	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23413906		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	15286007	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	17654061	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29434778		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	29434778		★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	33225648	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23353785		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26510790	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	19423651	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20173733, 23604756, 38052269	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24887547	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12588891, 15632006, 17158640, 20660789, 21037568, 26473286, 35977101, 40302096	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	15632006, 18430472, 20660789, 21037568, 26473286, 28877074		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	CTD_human_DG	21037568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	21037568, 24149102, 29196614		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	21037568, 24149102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin lymphoma, lymphocyte depletion	Hodgkin Lymphoma, Lymphocyte Depletion	CTD_human_DG	21037568		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	27556823		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypercalciuria	Hypercalciuria	Pubtator	32155322	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25894202	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	28928464	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31147243		★☆☆☆☆ Found in Text Mining only
Hypocalcemia	Hypocalcemia	Pubtator	28303854	Associate	★☆☆☆☆ Found in Text Mining only
Hypocalcemic seizures	Hypocalcemic seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	10508983, 10633131, 11389161, 14985365, 15705923, 16509533, 16912130, 16988501, 17210674, 19057839, 19248180, 20425828, 21157112, 21242646, 21399899, 23052618, 23186964, 23720234, 24622013, 25124981, 25771973, 25917456, 26514990, 26731259, 26777049, 27387476, 30534854, 31069810		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	LHGDN	14985365, 16509533, 16912130, 17114920		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	Pubtator	21157112, 21242646, 26216189, 26731259, 26800885, 31433868, 31660939, 37600721	Associate	★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism - autosomal dominant	Hypoparathyroidism	BEFREE	23435732		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism-sensorineural deafness-renal disease syndrome	Hypoparathyroidism-deafness-renal disease syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	26731259		★☆☆☆☆ Found in Text Mining only
Ichthyosiform Erythroderma, Congenital	Ichthyosis Congenita	BEFREE	26731259		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27796698		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	20333526, 21638273		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	21289214	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	15996929, 24412470, 31014934		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28263977, 30372555		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27639807		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30537794	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21537830		★☆☆☆☆ Found in Text Mining only
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Insulin-Dependent Diabetes Mellitus Secretory Diarrhea Syndrome	BEFREE	26748735		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27633145		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28288473		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22851040		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31187646		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	31238969		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21157112, 28566604, 33092653, 37908345	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29073906, 29663634		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	23052618		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	27556823, 27833659		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31636361	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36816543	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20656931, 28849107, 31519704		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23359050, 28415601	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37885041	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25552913, 31312355, 31419443		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	28393380		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22797725, 23106579, 35993027, 37667882	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17117487, 29155501		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18641361, 24683191	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24886807, 29161463, 33763079	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	17117487, 29155501		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16461436, 17117487, 22120729, 29155501, 30301440		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17117487		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	16461436, 30301440		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	17117487, 29155501		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31871924	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34057115, 36152841	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocyte Rich Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	21037568		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	31519704		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17272506		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17272506		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	17272506, 27589565	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23372669	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28842936, 30747224		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31317631, 31558678		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31558678	Associate	★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	29282470		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28935838, 30640051, 31431611		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28614203		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10096242, 16357129, 17078870, 18006915, 18268121, 18544966, 19082709, 19261198, 19405945, 19435916, 19483726, 19638208, 19728080, 20068169, 20189993, 20501593, 21761347, 21930782, 22120723, 23000897, 23354167, 23430443, 23435732, 23733266, 23851505, 24043118, 24205108, 24477928, 24758297, 25258321, 25410484, 25479686, 25713166, 25994056, 26028330, 26313026, 26486740, 26657142, 26922637, 27556158, 27588951, 27654269, 27867016, 28038704, 28211079, 28288473, 28394898, 28405154, 28423734, 28581515, 28700933, 28703335, 28722108, 28805661, 29340880, 29408697, 29431200, 29510139, 29535312, 29662164, 29902578, 29972720, 30061207, 30100605, 30125424, 30149959, 30354850, 30389437, 30468800, 30872657, 30928413, 31107186, 31218575, 31340200, 31409898, 31424658, 31492753, 31685800, 31718619, 31754326		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26657142		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	24743840		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25552913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22797725, 30093726, 30389437		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30059453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16087702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11712084, 23428429, 26451614, 27267060, 27322703, 27496770, 28346805, 28856847, 29662164, 31055834, 31482321, 31530761, 31564554		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29263701		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24448324, 27237631, 27612592, 27924948, 28765327, 29524970		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18533032, 19082709, 20189993, 21930782, 23549873, 23757729, 24504018, 24549248, 24758297, 25410484, 25529635, 25994056, 27283966, 28263977, 28288473, 28423734, 28581515, 28722108, 29187469, 29263701, 29434343, 29510139, 29746601, 30059453, 30100605, 30464506		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18217980, 28214368, 28940520, 31238167		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	24743840		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15361840, 18006915, 19189213, 19483726, 19622763, 19728080, 21761347, 23340433, 24448324, 24758297, 25479686, 27833659, 29262572, 29396493, 29535312, 30061207, 31218575, 31718619		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15361840, 17616709, 18268121		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28918859, 29479787		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28675510		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	28877074, 31831043		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30562218		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30728070, 34301206	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	32716568	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15057031, 26999588, 27992853, 28949314, 29053977, 29117870, 29235396, 30443924, 30637889, 30670990, 30997716, 31147243, 31415914		★☆☆☆☆ Found in Text Mining only
Mesothelial Neoplasms	Mesothelial Neoplasms	BEFREE	28582342		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24145643, 33501493	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28614203		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33501493	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	27556823		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	31020542		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28637449		★☆☆☆☆ Found in Text Mining only
Mixed Cellularity Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	21037568		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia T/myeloid	Mixed Phenotype Leukemia	BEFREE	28551327		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	28393380		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	24504018		★☆☆☆☆ Found in Text Mining only
Mucinous carcinoma of breast	Mucinous Carcinoma Of Breast	BEFREE	30649385		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15270865		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15270865	Inhibit	★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20847001, 31020542		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycosis Fungoides	Mycosis fungoides	Pubtator	27345620, 35642346	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29434778		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30115228		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	37798364	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	19639723, 23063330, 27166273, 31326962	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22462754, 30002685, 31326962		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	GWASCAT_DG	30643255		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11441075, 16212886, 16357129, 17078870, 18006915, 18268121, 19082709, 19189213, 19411068, 19483726, 21403400, 21761348, 21930782, 23354167, 23428429, 23435732, 23577196, 23996088, 24205108, 24504018, 24549248, 24713735, 24758297, 24887547, 25410484, 25479686, 25651379, 26317312, 27018307, 27237631, 28211079, 28215639, 28323779, 28394898, 28428106, 28481869, 28581515, 28582342, 28614203, 28675510, 29116378, 29194708, 29263701, 29317235, 29340880, 29408697, 29431200, 29434343, 29902578, 30061207, 30293951, 30390035, 30464506, 30718355, 30782609, 31020542, 31218575, 31279874, 31492753, 31718619, 31754326, 31828783, 31831043		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	16461436		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	BEFREE	23052618		★☆☆☆☆ Found in Text Mining only
Nephrocalcinosis	Nephrocalcinosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	19473628		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	19473628, 23052618		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	19473628		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19707195	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	20154722, 25351211, 28976719, 30127528, 30867811, 31831790		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	30127528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	31819055, 31831790, 36130928, 36598365	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27125358, 30390035		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	21037568		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	28877074		★☆☆☆☆ Found in Text Mining only
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	GWASCAT_DG	29196614		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21507199, 27893417		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24596378, 28084333, 28338653		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17030965, 29546532	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35401881	Inhibit	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27979316		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19405945, 21761347, 27997592		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35524376	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30464506		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	31515081		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22120723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31935430, 33921111, 34399777, 35405716, 35488350, 37303939	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	27556823		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16087702		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31033498		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16087702		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19798410	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	24145643	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	23599157, 24145643, 32892244	Associate	★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	30390035		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	15572854	Stimulate	★☆☆☆☆ Found in Text Mining only
Parathyroid hypoplasia	Parathyroid hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37373190	Inhibit	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	26595821, 31591497	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	35806269	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	19897590		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24497534, 24632715, 28842936, 30782609, 31562134		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	BEFREE	23359050		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28374498		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37334500	Associate	★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	24423332		★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG	23996088, 24141364, 24203929		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	23996088, 29296818, 29632299		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	24141364		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASDB_DG	24141364		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	GWASCAT_DG	25468567		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29434778, 30859636, 31519704		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	9819382		★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	29073906	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11712084, 23428429, 26451614, 27267060, 27322703, 27496770, 28346805, 28856847, 29662164, 31055834, 31482321, 31530761, 31564554, 31629838		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28656603	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18500686, 24185611	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23428429		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	21611195		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20333526, 21611195, 28928464		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28928464	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31320835, 34354706	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31820686		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26657142		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20208565, 24549248, 27556823, 28705707		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	10633131, 11389161, 14985365, 15705923, 23186964, 23720234, 24622013, 25124981, 25771973, 25917456, 26514990, 26777049, 27387476, 29593425		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	10633131, 11389161, 14985365, 15705923, 23186964, 23720234, 24622013, 25124981, 25771973, 25917456, 26514990, 26777049, 27387476, 29593425		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	23052618		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Tubular Acidosis, Type II	Renal Tubular Acidosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15286007, 19748983, 24614117		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	23143596, 24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	23143596, 24390342, 24532676, 30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	10856149, 18037162		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	18037162		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	18037162, 28598986	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	18037162, 36149748	Associate	★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	23604756	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	27249072, 36005179, 39491746	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29443850		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37552420	Associate	★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	28323779		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	26595821	Stimulate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	GWASCAT_DG	27723758		★☆☆☆☆ Found in Text Mining only
Senior Loken Syndrome	Senior-loken syndrome	Pubtator	24622013, 26514990, 26777049, 26800885, 28303854, 37600721	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	23666531, 24622013, 25771973, 29986705		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	BEFREE	23052618		★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29979219		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	28856847		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	16403914, 22951729, 36400759	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	22951729		★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	21242646		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	24205108	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15008986	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	15008986, 20333526, 29631029, 29726409		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12057898, 29434343, 30059453		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27036044, 36468944	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25994056		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27036044, 28263977		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25901741, 29263701		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17390031		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24338397, 24504018, 30365045	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24741632	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16418202, 21638273, 31789272		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17272506, 27780854		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	33159669	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	31713988		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	15526312		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24124001		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29663634		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	21892208, 23375642, 23549873, 23577196, 25068292, 28470571, 32687248, 34972751, 36157217	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23549873, 28038704, 28211079, 28428285, 28470571, 29340880, 30468800, 30628926		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36284362, 37077069	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25112700, 25526479, 27639807, 31068803		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★☆☆☆☆ Found in Text Mining only
Unilateral agenesis of kidney	Renal aplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	23599157	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	33716284	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24124001, 27237631, 31469885, 32546765, 32929335, 33858483, 36152841, 36323682, 36997051, 37542643, 37667882, 38052269, 39979991	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24448324	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	30484290	Stimulate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	17460449, 27642214, 28052688, 28291125, 28316088, 28374498, 28428106, 28614203, 28786878, 31020542		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	29434343	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12057898	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18217980, 36768623	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	28278322		★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vestibular Diseases	Vestibular disease	Pubtator	24622013	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	25917748		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	25917748		★☆☆☆☆ Found in Text Mining only
Waardenburg syndrome type 2	Waardenburg syndrome	Pubtator	36038884	Associate	★☆☆☆☆ Found in Text Mining only