Gene Gene information from NCBI Gene database.
Entrez ID 26235
Gene name F-box and leucine rich repeat protein 4
Gene symbol FBXL4
Synonyms (NCBI Gene)
FBL4FBL5MTDPS13
Chromosome 6
Chromosome location 6q16.1-q16.2
Summary This gene encodes a member of the F-box protein family, which are characterized by an approximately 40 amino acid motif, the F-box. F-box proteins constitute one subunit of modular E3 ubiquitin ligase complexes, called SCF complexes, which function in pho
SNPs SNP information provided by dbSNP.
60
SNP ID Visualize variation Clinical significance Consequence
rs200440128 G>A Pathogenic Coding sequence variant, stop gained, 5 prime UTR variant, non coding transcript variant
rs201889294 G>A,T Pathogenic Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, genic downstream transcript variant
rs201989042 T>G Likely-pathogenic, pathogenic-likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs368965675 C>A Pathogenic Splice acceptor variant
rs398123059 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
38
miRTarBase ID miRNA Experiments Reference
MIRT619238 hsa-miR-4795-5p HITS-CLIP 23824327
MIRT619237 hsa-miR-4513 HITS-CLIP 23824327
MIRT619236 hsa-miR-6855-3p HITS-CLIP 23824327
MIRT619235 hsa-miR-6857-3p HITS-CLIP 23824327
MIRT619234 hsa-miR-5189-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex TAS 10531035
GO:0000422 Process Autophagy of mitochondrion IEA
GO:0000422 Process Autophagy of mitochondrion IEA
GO:0000422 Process Autophagy of mitochondrion IMP 32525278
GO:0000423 Process Mitophagy IMP 22505714
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605654 13601 ENSG00000112234
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKA2
Protein name F-box/LRR-repeat protein 4 (F-box and leucine-rich repeat protein 4) (F-box protein FBL4/FBL5)
Protein function Substrate-recognition component of the mitochondria-localized SCF-FBXL4 ubiquitin E3 ligase complex that plays a role in the restriction of mitophagy by controlling the degradation of BNIP3 and NIX mitophagy receptors (PubMed:36896912, PubMed:38
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00646 F-box 279 323 F-box domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, kidney, liver, lung, pancreas, and placenta, but not in skeletal muscle. {ECO:0000269|PubMed:10531037}.
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLEYYTELDAVVLHGVKDKPVLSLKTSL
IDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHL
NLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFL
TANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNASFPKVFIKKSFTQ
Sequence length 621
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Developmental and epileptic encephalopathy, 85, with or without midline brain defects Likely pathogenic; Pathogenic rs398123060 RCV005861040
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay Likely pathogenic; Pathogenic rs398123061 RCV000162170
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leigh syndrome Likely pathogenic; Pathogenic rs2128375658, rs2534899241, rs879255542, rs773850151, rs201889294, rs398123061 RCV002266444
RCV003226794
RCV003226795
RCV004800434
RCV005237491
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mitochondrial DNA depletion syndrome Likely pathogenic; Pathogenic rs1582402094, rs201889294 RCV000825522
RCV000604628
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DEPLETION OF MITOCHONDRIAL DEOXYRIBONUCLEIC ACID Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FBXL4-related disorder Likely benign; Benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acidosis Lactic Lactic acidosis Pubtator 23993193, 25868664, 31442532, 32779419 Associate
★☆☆☆☆
Found in Text Mining only
Atrophy Atrophy Pubtator 23993194 Associate
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 23993193, 25868664, 32779419 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomegaly Cardiomegaly Pubtator 31442532 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy BEFREE 31442532
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy Pubtator 31442532 Associate
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy CLINVAR_DG 27182039
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital Epicanthus Congenital Epicanthus HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital lactic acidosis Congenital lactic acidosis BEFREE 27743463
★☆☆☆☆
Found in Text Mining only