Gene Gene information from NCBI Gene database.
Entrez ID 2622
Gene name Dynein regulatory complex subunit 4
Gene symbol DRC4
Synonyms (NCBI Gene)
CILD33GAS11GAS8
Chromosome 16
Chromosome location 16q24.3
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs141125763 G>C Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs748688175 C>A,T Pathogenic Synonymous variant, stop gained, coding sequence variant
rs755553133 C>T Pathogenic Stop gained, coding sequence variant
rs1597643228 G>- Likely-pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
196
miRTarBase ID miRNA Experiments Reference
MIRT019849 hsa-miR-375 Microarray 20215506
MIRT1012362 hsa-miR-1202 CLIP-seq
MIRT1012363 hsa-miR-1207-5p CLIP-seq
MIRT1012364 hsa-miR-1253 CLIP-seq
MIRT1012365 hsa-miR-125a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization ISS
GO:0003351 Process Epithelial cilium movement involved in extracellular fluid movement IEA
GO:0005515 Function Protein binding IPI 21659505, 32296183, 33961781, 34169321
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605178 4166 ENSG00000141013
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95995
Protein name Dynein regulatory complex subunit 4 (Growth arrest-specific protein 11) (GAS-11) (Growth arrest-specific protein 8) (GAS-8)
Protein function Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. Plays an important ro
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13851 GAS 221 420 Growth-arrest specific micro-tubule binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in respiratory epithelial cells (at protein level) (PubMed:26387594). Expressed in the heart, skeletal muscle, pancreas, liver, brain, trachea and lung. Weakly or not expressed in placenta and kidney (PubMed:9790751). {ECO:00
Sequence
MAPKKKGKKGKAKGTPIVDGLAPEDMSKEQVEEHVSRIREELDREREERNYFQLERDKIH
TFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLTEMKAEG
TVVMKLAQKEHRIQESVLRKDMRALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFER
QVREIEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDI
TLNNLALINSLKEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANY
ERDKQILLCTKARLKVREKELKDLQWEHEVLEQRFTKVQQERDELYRKFTAAIQEVQQKT
GFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDL

QYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGTPT
Sequence length 478
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Activation of SMO
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
21
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
GAS8-related disorder Pathogenic rs566755911 RCV003401099
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary ciliary dyskinesia 33 Likely pathogenic; Pathogenic rs778438857, rs143809463, rs909318705, rs755553133, rs566755911, rs2543473366, rs2543466489, rs765877577, rs781317147 RCV001376856
RCV001390394
RCV002644518
RCV000203538
RCV000203561
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthenozoospermia Asthenozoospermia HPO_DG
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 9790751
★☆☆☆☆
Found in Text Mining only
Bronchiectasis Bronchiectasis HPO_DG
★☆☆☆☆
Found in Text Mining only
Bronchitis, Chronic Gastric Cancer HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic otitis media Otitis media HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic rhinitis Rhinitis HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic sinusitis Sinusitis HPO_DG
★☆☆☆☆
Found in Text Mining only
Ciliary Dyskinesia, Primary, 1, With Or Without Situs Inversus Ciliary Dyskinesia ORPHANET_DG 26387594
★☆☆☆☆
Found in Text Mining only
CILIARY DYSKINESIA, PRIMARY, 33 Ciliary dyskinesia UNIPROT_DG 26387594, 27120127, 27472056
★★☆☆☆
Found in Text Mining + Unknown/Other Associations