GAS6 (growth arrest specific 6)

Gene

• Entrez ID: 2621
• Gene name: Growth arrest specific 6
• Gene symbol: GAS6
• Synonyms (NCBI Gene): AXLLG, AXSF
• Chromosome: 13
• Chromosome location: 13q34
• Summary: This gene encodes a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation. This gene is frequently overexpressed in many cancers and has been implicated as an adverse prognostic marker. Elevate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022472	hsa-miR-124-3p	Microarray	18668037
MIRT1012277	hsa-miR-1193	CLIP-seq
MIRT1012278	hsa-miR-3125	CLIP-seq
MIRT1012279	hsa-miR-3916	CLIP-seq
MIRT1012277	hsa-miR-1193	CLIP-seq
MIRT1549170	hsa-miR-190	CLIP-seq
MIRT1549171	hsa-miR-190b	CLIP-seq
MIRT1012278	hsa-miR-3125	CLIP-seq
MIRT1012279	hsa-miR-3916	CLIP-seq
MIRT1549172	hsa-miR-4267	CLIP-seq
MIRT1549173	hsa-miR-4310	CLIP-seq
MIRT1549174	hsa-miR-4438	CLIP-seq
MIRT1549175	hsa-miR-4699-3p	CLIP-seq
MIRT1549176	hsa-miR-5095	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IEA
GO:0001786	Function	Phosphatidylserine binding	IDA	21501828
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	7854420
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IMP	18840707
GO:0003104	Process	Positive regulation of glomerular filtration	IEA
GO:0003104	Process	Positive regulation of glomerular filtration	ISS
GO:0005102	Function	Signaling receptor binding	IDA	16359517
GO:0005102	Function	Signaling receptor binding	IPI	7854420
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16362042, 18760998, 20088931, 20103767
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8336730, 18395422, 19922767, 20088931
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	18395422
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006468	Process	Protein phosphorylation	IDA	16359517
GO:0006909	Process	Phagocytosis	IDA	21501828
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IDA	7854420, 18680538
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	20103767
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	19657094
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	19657094
GO:0016477	Process	Cell migration	IEA
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	IDA	21501828
GO:0019079	Process	Viral genome replication	IDA	21501828
GO:0030154	Process	Cell differentiation	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	21501828
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	7634325
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	ISS
GO:0032148	Process	Activation of protein kinase B activity	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IDA	18840707
GO:0032692	Process	Negative regulation of interleukin-1 production	IDA	20103767
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	19657094, 20103767
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	19657094, 20103767
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IDA	18840707
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IDA	19657094
GO:0035754	Process	B cell chemotaxis	IDA	19922767
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	16723520
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19922767
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043277	Process	Apoptotic cell clearance	IDA	21501828
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	7854420
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18680538
GO:0046718	Process	Symbiont entry into host cell	IDA	21501828
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	21501828
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	18680538
GO:0046872	Function	Metal ion binding	IEA
GO:0048018	Function	Receptor ligand activity	IBA
GO:0048018	Function	Receptor ligand activity	IDA	15184064, 20103767
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	15184064
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	7854420
GO:0050766	Process	Positive regulation of phagocytosis	IDA	18395422
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	16359517, 16723520, 18680538, 20103767
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070168	Process	Negative regulation of biomineral tissue development	IDA	20048160
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15184064
GO:0070588	Process	Calcium ion transmembrane transport	IDA	18395422
GO:0071307	Process	Cellular response to vitamin K	IDA	16359517
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	16359517
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	16359517
GO:0085029	Process	Extracellular matrix assembly	IEA
GO:0085029	Process	Extracellular matrix assembly	ISS
GO:0097028	Process	Dendritic cell differentiation	IEP	19657094
GO:0097241	Process	Hematopoietic stem cell migration to bone marrow	IDA	19922767
GO:1900142	Process	Negative regulation of oligodendrocyte apoptotic process	IDA	16723520
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IDA	16359517
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IEA
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	16359517, 18680538, 18760998
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IDA	19657094
GO:2000533	Process	Negative regulation of renal albumin absorption	IEA
GO:2000533	Process	Negative regulation of renal albumin absorption	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	19657094

Other IDs

• MIM: 600441
• HGNC: 4168
• e!Ensembl: ENSG00000183087

Protein

• UniProt ID: Q14393
• Protein name: Growth arrest-specific protein 6 (GAS-6) (AXL receptor tyrosine kinase ligand)
• Protein function: Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival d
• PDB: 1H30, 2C5D, 4RA0, 5VXZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00594	Gla	53 → 93	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain	Domain
  PF12661	hEGF	129 → 148	Human growth factor-like EGF	Domain
  PF12662	cEGF	177 → 200	Complement Clr-like EGF-like	Domain
  PF12661	hEGF	207 → 227	Human growth factor-like EGF	Domain
  PF07645	EGF_CA	238 → 277	Calcium-binding EGF domain	Domain
  PF00054	Laminin_G_1	325 → 454	Laminin G domain	Domain
  PF02210	Laminin_G_2	513 → 651	Laminin G domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Plasma. Isoform 1 and isoform 2 are widely expressed, isoform 1 being expressed at higher levels than isoform 2 in most tissues. Isoform 2 is the predominant form in spleen. {ECO:0000269|PubMed:8336730, ECO:0000269|PubMed:9326368}.
• Sequence:

  MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGH
  LERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQC
  TPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHC
  SCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVD
  ECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
  FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLR
  YNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLN
  LTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFY
  PGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALV
  DYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS
  AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAY
  KHSDITAHSCPPVEPAAA

• Sequence length: 678

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
Efferocytosis

Reactome:

Platelet degranulation
Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus
Removal of aminoterminal propeptides from gamma-carboxylated proteins
Cell surface interactions at the vascular wall
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANORECTAL MALFORMATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOEMBOLISM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	19369636		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	19564549		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19922767		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23982172		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23242819, 28440492		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19922767		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	24326683		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23209669, 25450174		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30852796		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	18188450		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18570189, 21384080, 23372645, 30508521		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23632195, 30335822		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10233855, 38283352	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19187333		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19187333	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10526166, 22907951, 32462812	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18570189, 21384080, 23372645, 30508521		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23372645	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36894947	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30729671, 31129420		★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31129420		★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	24762434		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22833165, 27222359		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27222359	Associate	★☆☆☆☆ Found in Text Mining only
Bjornstad syndrome	Bjornstad syndrome	Pubtator	31028135	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	16564713		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	19696043	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	29196212		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28551766	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18283315		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18283315	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33223203	Stimulate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	16556867, 26924277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11677117, 28272423		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20922806, 32909687	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19567592, 19888345, 25187556, 34611307, 35760058, 37348477	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	29734873	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27703030		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36635690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	39762897	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19369636, 26284522		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26284522, 30423812	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	36635690	Stimulate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35680486	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20664904		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15108283, 17721624, 19369636, 20664904		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15108283		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19922767		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30716432		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23430954		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27486820		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34344319, 38521199	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29119801, 30365934		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19567592, 31585940		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	31153870		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31153870		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26924277	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31153870		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	28450294		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10233855		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	23430954		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30508521		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28513288	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30508521		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26284522, 28399188, 35680486	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21959217, 25869052, 26284522, 28399188, 28453960, 31583710		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	24572151	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28513288	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	12644472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	18374201, 25869052, 28513288, 29511111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12796028		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12796028, 35588308	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36965901	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31110076		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31110076		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31110076, 32432570	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	BEFREE	29243516		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25528764		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30567378, 31583026		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12218057, 26863628, 27783662	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25980499, 31824472		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18172262		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	23826128	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29895432		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	23826128	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	23209669		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31300420	Stimulate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31300420		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31129420		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24572151, 31524235	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30710682		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29119801, 30365934		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36635690	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	30423812	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	30570809	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10400186		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	19567592		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31583710		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31226525		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22516347	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29634284		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29634284	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29382817		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26284522	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23430954		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	31655933		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	22907951	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22907951	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	19564549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	30716432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	23354874, 29024938		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	23354874		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	29024938	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10400186		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19922767, 34103328	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23474756, 24326683, 31028135	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18502572, 23474756, 23982172, 28333143, 28595195, 31028135		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	23354874, 29024938		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26573603	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24233839, 28833396, 30567378		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	32454903	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23497733	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22763415, 22833165, 23497733, 31655933		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	22833165, 30588607		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26207647	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10400186		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23209669	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17483321, 18283315		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31110076		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28333143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11677117, 22751098, 28272423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15452374, 27703030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26206560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15561781, 15605394, 22516347, 23637920, 27153245, 28814453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17186543, 30735718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31181609		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18381416, 22170610, 23430954, 23567973, 25102945, 26951083, 28333143, 28453960, 28675785, 29386018, 29416351, 31028135, 31186805, 31775787		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31162889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	32269179	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	25752901	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30346880		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	22516347		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25102945, 28154173		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28154173, 32298237, 35967396	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19541935, 23781120	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27630207, 27801848, 29514053		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27852702		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	10400186		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	27630207, 28270700, 29386018, 29868590, 31694201		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30365934		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36856591	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15605394, 17483321, 18283315, 19567592, 23242819, 23982172, 26206560, 26356564, 27153245, 27486820, 28327411, 28333143, 28551766, 28878389, 29386018, 30531835, 31419057, 31684958, 31824472		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30588607, 31655933		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	23318455		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	12644472		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28260071, 28551766, 28878389, 31419057, 31777195		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30531835		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26284522, 30346880, 30508521		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26284522, 28399188	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	31300420	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10233855	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32269179, 39174890	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15452374		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27703030		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33921111	Associate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	19567592		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26206560		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29157747, 31959629	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20922806		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19922767		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15561781, 15605394, 22516347, 23637920, 27153245, 28814453		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22516347, 28084441, 28771526, 35075375, 35595103	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	25752901	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29634284, 31284023		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	29634284	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19567592, 31585940		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	31319068		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10233855, 24702788		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	29024938		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	32454903	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31524235	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29176262, 29474201, 31263416, 31485279		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26445266	Inhibit	★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	19696043, 25703520		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29856094		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26207647	Stimulate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29119801		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	19696043, 25703520		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17186543, 30735718		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36894947, 40596960	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22907951	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37733241	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12490074, 31181609		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31181609		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	31129420		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27145494	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27923843		★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	27630207, 28270700, 29386018, 29868590, 31694201		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32269179, 34286546, 37313656	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24236135, 26924277, 31300420	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22763415		★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	22763415		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	30570809	Associate	★☆☆☆☆ Found in Text Mining only