Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26157
Gene name	GTPase, IMAP family member 2
Gene symbol	GIMAP2
Synonyms (NCBI Gene)	HIMAP2IAN12IMAP2
Chromosome	7
Chromosome location	7q36.1
Summary	This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 20

Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016593	hsa-miR-193b-3p	Microarray	20304954
MIRT019166	hsa-miR-335-5p	Microarray	18185580
MIRT1018960	hsa-miR-140-3p	CLIP-seq
MIRT1018961	hsa-miR-4693-5p	CLIP-seq
MIRT1018962	hsa-miR-5095	CLIP-seq
MIRT2234759	hsa-miR-487b	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0005515	Function	Protein binding	IPI	23454188, 32814053
GO:0005525	Function	GTP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005811	Component	Lipid droplet	IDA	23454188
GO:0005811	Component	Lipid droplet	IEA
GO:0042802	Function	Identical protein binding	IPI	21059949

MIM	HGNC	e!Ensembl
608085	21789	ENSG00000106560

Q9UG22

Protein name

GTPase IMAP family member 2 (Immunity-associated protein 2) (hIMAP2)

Protein function

The heterodimer formed by GIMAP2 and GIMAP7 has GTPase activity. In contrast, GIMAP2 has no GTPase activity by itself.

PDB

2XTM , 2XTN , 2XTO , 2XTP , 3P1J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04548	AIG1	23 → 234	AIG1 family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in T-cells. {ECO:0000269|PubMed:23454188}.

Sequence

MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKT
CSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTS
QDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRIC
AFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFK
QSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCC
LLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL

Sequence length

337

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Leukemia	Leukemia	Pubtator	36129940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33316779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GIMAP2 (GTPase, IMAP family member 2)