Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26146
Gene name	TRAF3 interacting protein 1
Gene symbol	TRAF3IP1
Synonyms (NCBI Gene)	CFAP116FAP116IFT54MIP-T3MIPT3SLSN9
Chromosome	2
Chromosome location	2q37.3
Summary	The protein encoded by this gene interacts with TNF receptor-associated factor 3, tethering it to cytoskeletal microtubules. The encoded protein is also an inhibitor of the innate type I IFN response. Defects in this gene are a cause of Senior-Loken syndr

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs146820102	C>G,T	Likely-benign, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs372499275	G>A,C	Pathogenic	Genic upstream transcript variant, intron variant, splice acceptor variant
rs750055952	T>G	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs764906529	G>-	Pathogenic	Splice acceptor variant
rs765903345	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained, genic upstream transcript variant
rs769651861	G>A	Pathogenic	Genic upstream transcript variant, non coding transcript variant, coding sequence variant, missense variant
rs886037896	T>C	Pathogenic	Coding sequence variant, non coding transcript variant, genic upstream transcript variant, missense variant
rs886037897	T>G	Pathogenic	Intron variant
rs886037898	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, genic upstream transcript variant, missense variant
rs886037899	T>C,G	Pathogenic	Coding sequence variant, genic upstream transcript variant, missense variant, synonymous variant, 5 prime UTR variant, non coding transcript variant
rs1553609359	T>G	Likely-pathogenic	Genic upstream transcript variant, intron variant

356

Show/Hide all (356)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050269	hsa-miR-25-3p	CLASH	23622248
MIRT049550	hsa-miR-92a-3p	CLASH	23622248
MIRT037104	hsa-miR-877-3p	CLASH	23622248
MIRT717319	hsa-miR-320e	HITS-CLIP	19536157
MIRT717318	hsa-miR-3184-3p	HITS-CLIP	19536157
MIRT717317	hsa-miR-1264	HITS-CLIP	19536157
MIRT717316	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT717315	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT717314	hsa-miR-4781-3p	HITS-CLIP	19536157
MIRT717313	hsa-miR-3685	HITS-CLIP	19536157
MIRT717312	hsa-miR-384	HITS-CLIP	19536157
MIRT717311	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT717310	hsa-miR-517c-3p	HITS-CLIP	19536157
MIRT717309	hsa-miR-519a-3p	HITS-CLIP	19536157
MIRT717308	hsa-miR-519b-3p	HITS-CLIP	19536157
MIRT628691	hsa-miR-490-3p	HITS-CLIP	23824327
MIRT628690	hsa-miR-5693	HITS-CLIP	23824327
MIRT628689	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT628688	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT628687	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT628686	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT628685	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT628684	hsa-miR-4284	HITS-CLIP	23824327
MIRT628683	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT628682	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT628681	hsa-miR-7977	HITS-CLIP	23824327
MIRT628680	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT628679	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT528391	hsa-miR-548n	PAR-CLIP	22012620
MIRT528390	hsa-miR-548av-5p	PAR-CLIP	22012620
MIRT528389	hsa-miR-548k	PAR-CLIP	22012620
MIRT528388	hsa-miR-8054	PAR-CLIP	22012620
MIRT528387	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT528386	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT528385	hsa-miR-5196-3p	PAR-CLIP	22012620
MIRT528384	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528383	hsa-miR-3927-5p	PAR-CLIP	22012620
MIRT528382	hsa-miR-205-5p	PAR-CLIP	22012620
MIRT528381	hsa-miR-4672	PAR-CLIP	22012620
MIRT528380	hsa-miR-1298-5p	PAR-CLIP	22012620
MIRT717319	hsa-miR-320e	HITS-CLIP	19536157
MIRT717318	hsa-miR-3184-3p	HITS-CLIP	19536157
MIRT717317	hsa-miR-1264	HITS-CLIP	19536157
MIRT717316	hsa-miR-22-3p	HITS-CLIP	19536157
MIRT717315	hsa-miR-501-5p	HITS-CLIP	19536157
MIRT717314	hsa-miR-4781-3p	HITS-CLIP	19536157
MIRT717313	hsa-miR-3685	HITS-CLIP	19536157
MIRT717312	hsa-miR-384	HITS-CLIP	19536157
MIRT717311	hsa-miR-7856-5p	HITS-CLIP	19536157
MIRT717310	hsa-miR-517c-3p	HITS-CLIP	19536157
MIRT717309	hsa-miR-519a-3p	HITS-CLIP	19536157
MIRT717308	hsa-miR-519b-3p	HITS-CLIP	19536157
MIRT628691	hsa-miR-490-3p	HITS-CLIP	23824327
MIRT628690	hsa-miR-5693	HITS-CLIP	23824327
MIRT628689	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT628688	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT628687	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT628686	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT628685	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT628684	hsa-miR-4284	HITS-CLIP	23824327
MIRT628683	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT628682	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT628681	hsa-miR-7977	HITS-CLIP	23824327
MIRT628680	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT628679	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT528391	hsa-miR-548n	PAR-CLIP	22012620
MIRT528390	hsa-miR-548av-5p	PAR-CLIP	22012620
MIRT528389	hsa-miR-548k	PAR-CLIP	22012620
MIRT528388	hsa-miR-8054	PAR-CLIP	22012620
MIRT528387	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT528386	hsa-miR-3613-3p	PAR-CLIP	22012620
MIRT528385	hsa-miR-5196-3p	PAR-CLIP	22012620
MIRT528384	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528383	hsa-miR-3927-5p	PAR-CLIP	22012620
MIRT528382	hsa-miR-205-5p	PAR-CLIP	22012620
MIRT528381	hsa-miR-4672	PAR-CLIP	22012620
MIRT528380	hsa-miR-1298-5p	PAR-CLIP	22012620
MIRT1450888	hsa-miR-1470	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT1450891	hsa-miR-3125	CLIP-seq
MIRT1450892	hsa-miR-3166	CLIP-seq
MIRT1450893	hsa-miR-3179	CLIP-seq
MIRT1450894	hsa-miR-335	CLIP-seq
MIRT1450895	hsa-miR-3664-3p	CLIP-seq
MIRT1450896	hsa-miR-3714	CLIP-seq
MIRT1450897	hsa-miR-3916	CLIP-seq
MIRT1450898	hsa-miR-3929	CLIP-seq
MIRT1450899	hsa-miR-411	CLIP-seq
MIRT1450900	hsa-miR-4419b	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT1450903	hsa-miR-4478	CLIP-seq
MIRT1450904	hsa-miR-4649-3p	CLIP-seq
MIRT1450905	hsa-miR-4667-3p	CLIP-seq
MIRT1450906	hsa-miR-4695-5p	CLIP-seq
MIRT1450907	hsa-miR-4722-5p	CLIP-seq
MIRT1450908	hsa-miR-4760-3p	CLIP-seq
MIRT1450909	hsa-miR-4764-3p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT1450911	hsa-miR-485-5p	CLIP-seq
MIRT1450912	hsa-miR-510	CLIP-seq
MIRT1450913	hsa-miR-512-5p	CLIP-seq
MIRT1450914	hsa-miR-548an	CLIP-seq
MIRT1450915	hsa-miR-935	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT1450917	hsa-miR-1273	CLIP-seq
MIRT1450918	hsa-miR-1273g	CLIP-seq
MIRT1450919	hsa-miR-148a	CLIP-seq
MIRT1450920	hsa-miR-148b	CLIP-seq
MIRT1450921	hsa-miR-152	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450922	hsa-miR-1912	CLIP-seq
MIRT1450923	hsa-miR-203	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT1450924	hsa-miR-24	CLIP-seq
MIRT1450925	hsa-miR-27a	CLIP-seq
MIRT1450926	hsa-miR-27b	CLIP-seq
MIRT1450927	hsa-miR-3117-3p	CLIP-seq
MIRT1450928	hsa-miR-3122	CLIP-seq
MIRT1450891	hsa-miR-3125	CLIP-seq
MIRT1450929	hsa-miR-3164	CLIP-seq
MIRT1450930	hsa-miR-324-5p	CLIP-seq
MIRT1450894	hsa-miR-335	CLIP-seq
MIRT1450895	hsa-miR-3664-3p	CLIP-seq
MIRT1450931	hsa-miR-3667-5p	CLIP-seq
MIRT1450932	hsa-miR-3689a-3p	CLIP-seq
MIRT1450933	hsa-miR-3689c	CLIP-seq
MIRT1450934	hsa-miR-3913-5p	CLIP-seq
MIRT1450897	hsa-miR-3916	CLIP-seq
MIRT1450935	hsa-miR-3921	CLIP-seq
MIRT1450898	hsa-miR-3929	CLIP-seq
MIRT1450936	hsa-miR-3937	CLIP-seq
MIRT1450899	hsa-miR-411	CLIP-seq
MIRT1450937	hsa-miR-4252	CLIP-seq
MIRT1450938	hsa-miR-4257	CLIP-seq
MIRT1450939	hsa-miR-4307	CLIP-seq
MIRT1450900	hsa-miR-4419b	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT1450903	hsa-miR-4478	CLIP-seq
MIRT1450904	hsa-miR-4649-3p	CLIP-seq
MIRT1450940	hsa-miR-4653-5p	CLIP-seq
MIRT1450906	hsa-miR-4695-5p	CLIP-seq
MIRT1450907	hsa-miR-4722-5p	CLIP-seq
MIRT1450941	hsa-miR-4728-5p	CLIP-seq
MIRT1450942	hsa-miR-4738-3p	CLIP-seq
MIRT1450943	hsa-miR-4743	CLIP-seq
MIRT1450944	hsa-miR-4766-5p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT1450945	hsa-miR-4789-5p	CLIP-seq
MIRT1450911	hsa-miR-485-5p	CLIP-seq
MIRT1450946	hsa-miR-5096	CLIP-seq
MIRT1450912	hsa-miR-510	CLIP-seq
MIRT1450913	hsa-miR-512-5p	CLIP-seq
MIRT1450947	hsa-miR-513a-5p	CLIP-seq
MIRT1450948	hsa-miR-518e	CLIP-seq
MIRT1450949	hsa-miR-654-3p	CLIP-seq
MIRT1450950	hsa-miR-671-5p	CLIP-seq
MIRT1450951	hsa-miR-711	CLIP-seq
MIRT1450952	hsa-miR-766	CLIP-seq
MIRT1450953	hsa-miR-876-3p	CLIP-seq
MIRT1450915	hsa-miR-935	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450924	hsa-miR-24	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT1450943	hsa-miR-4743	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT2134789	hsa-miR-499-5p	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT2356038	hsa-miR-101	CLIP-seq
MIRT2356039	hsa-miR-1261	CLIP-seq
MIRT1450917	hsa-miR-1273	CLIP-seq
MIRT2356040	hsa-miR-1287	CLIP-seq
MIRT2356041	hsa-miR-1299	CLIP-seq
MIRT2356042	hsa-miR-144	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT2356043	hsa-miR-208a	CLIP-seq
MIRT2356044	hsa-miR-208b	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT2356045	hsa-miR-224	CLIP-seq
MIRT1450924	hsa-miR-24	CLIP-seq
MIRT1450925	hsa-miR-27a	CLIP-seq
MIRT1450926	hsa-miR-27b	CLIP-seq
MIRT1450928	hsa-miR-3122	CLIP-seq
MIRT2356046	hsa-miR-3127-5p	CLIP-seq
MIRT1450892	hsa-miR-3166	CLIP-seq
MIRT2356047	hsa-miR-3173-3p	CLIP-seq
MIRT2356048	hsa-miR-3202	CLIP-seq
MIRT2356049	hsa-miR-320a	CLIP-seq
MIRT2356050	hsa-miR-320b	CLIP-seq
MIRT2356051	hsa-miR-320c	CLIP-seq
MIRT2356052	hsa-miR-320d	CLIP-seq
MIRT2356053	hsa-miR-34b	CLIP-seq
MIRT2356054	hsa-miR-3647-3p	CLIP-seq
MIRT1450895	hsa-miR-3664-3p	CLIP-seq
MIRT1450932	hsa-miR-3689a-3p	CLIP-seq
MIRT1450933	hsa-miR-3689c	CLIP-seq
MIRT1450896	hsa-miR-3714	CLIP-seq
MIRT1450934	hsa-miR-3913-5p	CLIP-seq
MIRT1450898	hsa-miR-3929	CLIP-seq
MIRT1450937	hsa-miR-4252	CLIP-seq
MIRT1450938	hsa-miR-4257	CLIP-seq
MIRT2356055	hsa-miR-4328	CLIP-seq
MIRT1450900	hsa-miR-4419b	CLIP-seq
MIRT2356056	hsa-miR-4429	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT1450903	hsa-miR-4478	CLIP-seq
MIRT2356057	hsa-miR-4533	CLIP-seq
MIRT2356058	hsa-miR-4537	CLIP-seq
MIRT1450904	hsa-miR-4649-3p	CLIP-seq
MIRT2356059	hsa-miR-4666-3p	CLIP-seq
MIRT2356060	hsa-miR-4676-5p	CLIP-seq
MIRT1450906	hsa-miR-4695-5p	CLIP-seq
MIRT1450907	hsa-miR-4722-5p	CLIP-seq
MIRT1450941	hsa-miR-4728-5p	CLIP-seq
MIRT1450943	hsa-miR-4743	CLIP-seq
MIRT1450908	hsa-miR-4760-3p	CLIP-seq
MIRT1450944	hsa-miR-4766-5p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT1450945	hsa-miR-4789-5p	CLIP-seq
MIRT1450911	hsa-miR-485-5p	CLIP-seq
MIRT2134789	hsa-miR-499-5p	CLIP-seq
MIRT1450912	hsa-miR-510	CLIP-seq
MIRT1450913	hsa-miR-512-5p	CLIP-seq
MIRT1450947	hsa-miR-513a-5p	CLIP-seq
MIRT1450948	hsa-miR-518e	CLIP-seq
MIRT2356061	hsa-miR-520d-5p	CLIP-seq
MIRT2356062	hsa-miR-524-5p	CLIP-seq
MIRT1450914	hsa-miR-548an	CLIP-seq
MIRT2356063	hsa-miR-570	CLIP-seq
MIRT2356064	hsa-miR-575	CLIP-seq
MIRT2356065	hsa-miR-582-5p	CLIP-seq
MIRT2356066	hsa-miR-583	CLIP-seq
MIRT2356067	hsa-miR-624	CLIP-seq
MIRT1450950	hsa-miR-671-5p	CLIP-seq
MIRT1450952	hsa-miR-766	CLIP-seq
MIRT2356068	hsa-miR-875-3p	CLIP-seq
MIRT1450915	hsa-miR-935	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT1450928	hsa-miR-3122	CLIP-seq
MIRT1450895	hsa-miR-3664-3p	CLIP-seq
MIRT1450932	hsa-miR-3689a-3p	CLIP-seq
MIRT1450933	hsa-miR-3689c	CLIP-seq
MIRT1450934	hsa-miR-3913-5p	CLIP-seq
MIRT1450898	hsa-miR-3929	CLIP-seq
MIRT1450936	hsa-miR-3937	CLIP-seq
MIRT1450900	hsa-miR-4419b	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT1450903	hsa-miR-4478	CLIP-seq
MIRT1450941	hsa-miR-4728-5p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT2134789	hsa-miR-499-5p	CLIP-seq
MIRT1450912	hsa-miR-510	CLIP-seq
MIRT1450913	hsa-miR-512-5p	CLIP-seq
MIRT1450915	hsa-miR-935	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT2649510	hsa-miR-1271	CLIP-seq
MIRT1450917	hsa-miR-1273	CLIP-seq
MIRT2649511	hsa-miR-1285	CLIP-seq
MIRT2649512	hsa-miR-182	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT2649513	hsa-miR-23a	CLIP-seq
MIRT2649514	hsa-miR-23b	CLIP-seq
MIRT2649515	hsa-miR-23c	CLIP-seq
MIRT1450924	hsa-miR-24	CLIP-seq
MIRT2649516	hsa-miR-300	CLIP-seq
MIRT1450928	hsa-miR-3122	CLIP-seq
MIRT2356046	hsa-miR-3127-5p	CLIP-seq
MIRT1450892	hsa-miR-3166	CLIP-seq
MIRT2649517	hsa-miR-3187-5p	CLIP-seq
MIRT2356053	hsa-miR-34b	CLIP-seq
MIRT2649518	hsa-miR-3545-3p	CLIP-seq
MIRT2649519	hsa-miR-3614-5p	CLIP-seq
MIRT2649520	hsa-miR-3616-5p	CLIP-seq
MIRT2649521	hsa-miR-3622b-5p	CLIP-seq
MIRT2356054	hsa-miR-3647-3p	CLIP-seq
MIRT2649522	hsa-miR-3647-5p	CLIP-seq
MIRT1450895	hsa-miR-3664-3p	CLIP-seq
MIRT2649523	hsa-miR-3675-3p	CLIP-seq
MIRT1450932	hsa-miR-3689a-3p	CLIP-seq
MIRT1450933	hsa-miR-3689c	CLIP-seq
MIRT2649524	hsa-miR-3689d	CLIP-seq
MIRT1450896	hsa-miR-3714	CLIP-seq
MIRT2649525	hsa-miR-371-5p	CLIP-seq
MIRT2649526	hsa-miR-381	CLIP-seq
MIRT1450934	hsa-miR-3913-5p	CLIP-seq
MIRT1450936	hsa-miR-3937	CLIP-seq
MIRT2649527	hsa-miR-3945	CLIP-seq
MIRT1450937	hsa-miR-4252	CLIP-seq
MIRT2649528	hsa-miR-4253	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT2649529	hsa-miR-4635	CLIP-seq
MIRT2356059	hsa-miR-4666-3p	CLIP-seq
MIRT2649530	hsa-miR-4680-5p	CLIP-seq
MIRT2649531	hsa-miR-4684-5p	CLIP-seq
MIRT1450907	hsa-miR-4722-5p	CLIP-seq
MIRT2649532	hsa-miR-4724-5p	CLIP-seq
MIRT1450941	hsa-miR-4728-5p	CLIP-seq
MIRT1450908	hsa-miR-4760-3p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT2649533	hsa-miR-4786-5p	CLIP-seq
MIRT2134789	hsa-miR-499-5p	CLIP-seq
MIRT1450912	hsa-miR-510	CLIP-seq
MIRT1450913	hsa-miR-512-5p	CLIP-seq
MIRT1450914	hsa-miR-548an	CLIP-seq
MIRT2649534	hsa-miR-573	CLIP-seq
MIRT2649535	hsa-miR-612	CLIP-seq
MIRT2649536	hsa-miR-618	CLIP-seq
MIRT2356067	hsa-miR-624	CLIP-seq
MIRT1450952	hsa-miR-766	CLIP-seq
MIRT1450915	hsa-miR-935	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq
MIRT2649537	hsa-miR-96	CLIP-seq
MIRT1450917	hsa-miR-1273	CLIP-seq
MIRT2649511	hsa-miR-1285	CLIP-seq
MIRT1450889	hsa-miR-1827	CLIP-seq
MIRT1450890	hsa-miR-2114	CLIP-seq
MIRT1450928	hsa-miR-3122	CLIP-seq
MIRT2649517	hsa-miR-3187-5p	CLIP-seq
MIRT2356053	hsa-miR-34b	CLIP-seq
MIRT2649518	hsa-miR-3545-3p	CLIP-seq
MIRT2649519	hsa-miR-3614-5p	CLIP-seq
MIRT2649521	hsa-miR-3622b-5p	CLIP-seq
MIRT2356054	hsa-miR-3647-3p	CLIP-seq
MIRT2649523	hsa-miR-3675-3p	CLIP-seq
MIRT1450932	hsa-miR-3689a-3p	CLIP-seq
MIRT1450933	hsa-miR-3689c	CLIP-seq
MIRT2649524	hsa-miR-3689d	CLIP-seq
MIRT2649525	hsa-miR-371-5p	CLIP-seq
MIRT1450934	hsa-miR-3913-5p	CLIP-seq
MIRT1450936	hsa-miR-3937	CLIP-seq
MIRT2649527	hsa-miR-3945	CLIP-seq
MIRT1450937	hsa-miR-4252	CLIP-seq
MIRT2649528	hsa-miR-4253	CLIP-seq
MIRT1450901	hsa-miR-4433	CLIP-seq
MIRT1450902	hsa-miR-4459	CLIP-seq
MIRT2649530	hsa-miR-4680-5p	CLIP-seq
MIRT2649531	hsa-miR-4684-5p	CLIP-seq
MIRT1450907	hsa-miR-4722-5p	CLIP-seq
MIRT2649532	hsa-miR-4724-5p	CLIP-seq
MIRT1450941	hsa-miR-4728-5p	CLIP-seq
MIRT1450910	hsa-miR-4768-3p	CLIP-seq
MIRT2649533	hsa-miR-4786-5p	CLIP-seq
MIRT2134789	hsa-miR-499-5p	CLIP-seq
MIRT2649535	hsa-miR-612	CLIP-seq
MIRT1450952	hsa-miR-766	CLIP-seq
MIRT1450916	hsa-miR-940	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0001738	Process	Morphogenesis of a polarized epithelium	IDA	26487268
GO:0001738	Process	Morphogenesis of a polarized epithelium	IEA
GO:0001822	Process	Kidney development	IMP	26487268
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	22079989
GO:0005515	Function	Protein binding	IPI	10791955, 12812986, 12935900, 17043677, 20391533, 30021884, 31413325, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	NAS	26980730
GO:0005929	Component	Cilium	TAS
GO:0005930	Component	Axoneme	IBA
GO:0005930	Component	Axoneme	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0021532	Process	Neural tube patterning	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030992	Component	Intraciliary transport particle B	IBA
GO:0030992	Component	Intraciliary transport particle B	IEA
GO:0030992	Component	Intraciliary transport particle B	IPI	26980730
GO:0030992	Component	Intraciliary transport particle B	ISS
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	22079989
GO:0032480	Process	Negative regulation of type I interferon production	IEA
GO:0032480	Process	Negative regulation of type I interferon production	IMP	22079989
GO:0032688	Process	Negative regulation of interferon-beta production	IEA
GO:0035050	Process	Embryonic heart tube development	IEA
GO:0035720	Process	Intraciliary anterograde transport	NAS	26980730
GO:0035869	Component	Ciliary transition zone	IDA	26487268
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042073	Process	Intraciliary transport	IBA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048731	Process	System development	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IMP	22079989
GO:0051607	Process	Defense response to virus	IEA
GO:0060271	Process	Cilium assembly	IBA
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	NAS	26980730
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IMP	26487268
GO:0097542	Component	Ciliary tip	IDA	26487268
GO:0097542	Component	Ciliary tip	TAS
GO:0097546	Component	Ciliary base	IDA	26487268

MIM	HGNC	e!Ensembl
607380	17861	ENSG00000204104

Q8TDR0

Protein name

TRAF3-interacting protein 1 (Interleukin-13 receptor alpha 1-binding protein 1) (Intraflagellar transport protein 54 homolog) (Microtubule-interacting protein associated with TRAF3) (MIP-T3)

Protein function

Plays an inhibitory role on IL13 signaling by binding to IL13RA1. Involved in suppression of IL13-induced STAT6 phosphorylation, transcriptional activity and DNA-binding. Recruits TRAF3 and DISC1 to the microtubules. Involved in kidney developme

PDB

2EQO , 8KCQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10243	MIP-T3	5 → 117	Microtubule-binding protein MIP-T3 CH-like domain	Domain
PF17749	MIP-T3_C	532 → 685	Microtubule-binding protein MIP-T3 C-terminal region	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12935900}.

Sequence

MNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKS
DNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLS
SDDAVRRVLAGEKGEVKGRASLTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSR
DRKQKEELKEDRKPREKDKDKEKAKENGGNRHREGERERAKARARPDNERQKDRGNRERD
RDSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRRRVKNGEHSWDLDREKNREHD
KPEKKSASSGEMSKKLSDGTFKDSKAETETEISTRASKSLTTKTSKRRSKNSVEGRKEDN
ISAKSLDSIVSGINNEPNQETTTSEIGTKEANINSTSISDDNSASLRCENIQPNPTEKQK
GDSTSDAEGDAGPAGQDKSEVPETPEIPNELSSNIRRIPRPGSARPAPPRVKRQDSMEAL
QMDRSGSGKTVSNVITESHNSDNEEDDQFVVEAAPQLSEMSEIEMVTAVELEEEEKHGGL
VKKILETKKDYEKLQQSPKPGEKERSLFESAWKKEKDIVSKEIEKLRTSIQTLCKSALPL
GKIMDYIQEDVDAMQNELQMWHSENRQHAEALQQEQRITDCAVEPLKAELAELEQLIKDQ
QDKICAVKANILKNEEKIQKMVYSINLTSRR

Sequence length

691

Interactions

View interactions

	Reactome
			Intraflagellar transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cervical cancer	Likely pathogenic	rs905244464	RCV005925508	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Senior-Loken syndrome 9	Pathogenic; Likely pathogenic	rs886037896, rs765903345, rs886037897, rs886037898, rs886037899, rs1358016801, rs745954112	RCV000240625 RCV000240637 RCV000240622 RCV000240633 RCV000240646 RCV004547379 RCV005394661 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Short-rib thoracic dysplasia 6 with or without polydactyly	Likely pathogenic; Pathogenic	rs769651861, rs372499275	RCV000516088 RCV000515883	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TRAF3IP1-related disorder	Likely pathogenic	rs372499275	RCV003409730	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIOPATHY	—	ClinGen, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ellis-van Creveld syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Jeune thoracic dystrophy	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MAJEWSKI SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENIOR-LOKEN SYNDROME	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENIOR-LOKEN SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHORT RIB-POLYDACTYLY SYNDROME, MAJEWSKI TYPE	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Age related macular degeneration	Age-related macular degeneration	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	GWASCAT_DG	30306274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	26487268		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ciliopathies	Ciliopathy	Pubtator	29068549	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Fibrosis, Congenital	Congenital Hepatic Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Jeune thoracic dystrophy	Jeune Thoracic Dystrophy	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Majewski Syndrome	Majewski Syndrome	ORPHANET_DG	29068549		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Majewski Syndrome	Majewski Syndrome	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephritis, Tubulointerstitial	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	26487268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32104517	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia and retinal aplasia (disorder)	Renal dysplasia and retinal aplasia	ORPHANET_DG	26487268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rod-Cone Dystrophy	Rod-cone dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Senior-Loken syndrome	Senior-Loken Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENIOR-LOKEN SYNDROME 9	Senior-Loken Syndrome	UNIPROT_DG	26487268		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SENIOR-LOKEN SYNDROME 9	Senior-Loken Syndrome	GENOMICS_ENGLAND_DG	26487268		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SENIOR-LOKEN SYNDROME 9	Senior-Loken Syndrome	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Short rib-polydactyly syndrome, Majewski type	Short Rib-Polydactyly Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF3IP1 (TRAF3 interacting protein 1)