Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26145
Gene name	Interferon regulatory factor 2 binding protein 1
Gene symbol	IRF2BP1
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.32

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021548	hsa-miR-142-3p	Microarray	17612493
MIRT037736	hsa-miR-744-5p	CLASH	23622248
MIRT1070958	hsa-miR-1293	CLIP-seq
MIRT1070959	hsa-miR-15a	CLIP-seq
MIRT1070960	hsa-miR-15b	CLIP-seq
MIRT1070961	hsa-miR-16	CLIP-seq
MIRT1070962	hsa-miR-195	CLIP-seq
MIRT1070963	hsa-miR-2467-3p	CLIP-seq
MIRT1070964	hsa-miR-3173-3p	CLIP-seq
MIRT1070965	hsa-miR-361-3p	CLIP-seq
MIRT1070966	hsa-miR-3616-3p	CLIP-seq
MIRT1070967	hsa-miR-3688-5p	CLIP-seq
MIRT1070968	hsa-miR-424	CLIP-seq
MIRT1070969	hsa-miR-4293	CLIP-seq
MIRT1070970	hsa-miR-4433	CLIP-seq
MIRT1070971	hsa-miR-4436b-3p	CLIP-seq
MIRT1070972	hsa-miR-4459	CLIP-seq
MIRT1070973	hsa-miR-4470	CLIP-seq
MIRT1070974	hsa-miR-4483	CLIP-seq
MIRT1070975	hsa-miR-4688	CLIP-seq
MIRT1070976	hsa-miR-4728-5p	CLIP-seq
MIRT1070977	hsa-miR-4768-3p	CLIP-seq
MIRT1070978	hsa-miR-4779	CLIP-seq
MIRT1070979	hsa-miR-486-3p	CLIP-seq
MIRT1070980	hsa-miR-497	CLIP-seq
MIRT1070981	hsa-miR-513c	CLIP-seq
MIRT1070982	hsa-miR-514b-5p	CLIP-seq
MIRT1070983	hsa-miR-545	CLIP-seq
MIRT1070984	hsa-miR-596	CLIP-seq
MIRT1070985	hsa-miR-765	CLIP-seq
MIRT1070986	hsa-miR-885-3p	CLIP-seq
MIRT2017455	hsa-miR-1587	CLIP-seq
MIRT2017456	hsa-miR-378g	CLIP-seq
MIRT2017457	hsa-miR-4492	CLIP-seq
MIRT2017458	hsa-miR-4498	CLIP-seq
MIRT2017459	hsa-miR-4505	CLIP-seq
MIRT2017460	hsa-miR-4656	CLIP-seq
MIRT2017461	hsa-miR-4675	CLIP-seq
MIRT1070976	hsa-miR-4728-5p	CLIP-seq
MIRT2017462	hsa-miR-4741	CLIP-seq
MIRT2017463	hsa-miR-542-5p	CLIP-seq
MIRT2017464	hsa-miR-762	CLIP-seq
MIRT2249365	hsa-miR-1254	CLIP-seq
MIRT1070958	hsa-miR-1293	CLIP-seq
MIRT2017455	hsa-miR-1587	CLIP-seq
MIRT1070959	hsa-miR-15a	CLIP-seq
MIRT1070960	hsa-miR-15b	CLIP-seq
MIRT1070961	hsa-miR-16	CLIP-seq
MIRT2249366	hsa-miR-1827	CLIP-seq
MIRT1070962	hsa-miR-195	CLIP-seq
MIRT2249367	hsa-miR-2682	CLIP-seq
MIRT2249368	hsa-miR-3116	CLIP-seq
MIRT1070964	hsa-miR-3173-3p	CLIP-seq
MIRT2249369	hsa-miR-34a	CLIP-seq
MIRT2249370	hsa-miR-34c-5p	CLIP-seq
MIRT2249371	hsa-miR-3612	CLIP-seq
MIRT1070967	hsa-miR-3688-5p	CLIP-seq
MIRT2017456	hsa-miR-378g	CLIP-seq
MIRT1070968	hsa-miR-424	CLIP-seq
MIRT2249372	hsa-miR-4254	CLIP-seq
MIRT1070969	hsa-miR-4293	CLIP-seq
MIRT2249373	hsa-miR-4443	CLIP-seq
MIRT1070973	hsa-miR-4470	CLIP-seq
MIRT1070974	hsa-miR-4483	CLIP-seq
MIRT2017457	hsa-miR-4492	CLIP-seq
MIRT2017458	hsa-miR-4498	CLIP-seq
MIRT2249374	hsa-miR-449a	CLIP-seq
MIRT2249375	hsa-miR-449b	CLIP-seq
MIRT2249376	hsa-miR-449c	CLIP-seq
MIRT2017459	hsa-miR-4505	CLIP-seq
MIRT2249377	hsa-miR-4536	CLIP-seq
MIRT2017460	hsa-miR-4656	CLIP-seq
MIRT2017461	hsa-miR-4675	CLIP-seq
MIRT1070975	hsa-miR-4688	CLIP-seq
MIRT1070976	hsa-miR-4728-5p	CLIP-seq
MIRT2017462	hsa-miR-4741	CLIP-seq
MIRT1070978	hsa-miR-4779	CLIP-seq
MIRT1070980	hsa-miR-497	CLIP-seq
MIRT1070981	hsa-miR-513c	CLIP-seq
MIRT1070982	hsa-miR-514b-5p	CLIP-seq
MIRT2017463	hsa-miR-542-5p	CLIP-seq
MIRT1070983	hsa-miR-545	CLIP-seq
MIRT1070984	hsa-miR-596	CLIP-seq
MIRT2249378	hsa-miR-650	CLIP-seq
MIRT2017464	hsa-miR-762	CLIP-seq
MIRT1070985	hsa-miR-765	CLIP-seq
MIRT1070986	hsa-miR-885-3p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12799427
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18671972
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	18671972
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	12799427, 18671972
GO:0005515	Function	Protein binding	IPI	18671972
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12799427
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	18671972
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
615331	21728	ENSG00000170604

Q8IU81

Protein name

Interferon regulatory factor 2-binding protein 1 (IRF-2-binding protein 1) (IRF-2BP1) (Probable E3 ubiquitin-protein ligase IRF2BP1) (EC 2.3.2.27) (Probable RING-type E3 ubiquitin transferase IRF2BP1)

Protein function

Acts as a transcriptional corepressor in a IRF2-dependent manner; this repression is not mediated by histone deacetylase activities. May act as an E3 ligase towards JDP2, enhancing its polyubiquitination. Represses ATF2-dependent transcriptional

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11261	IRF-2BP1_2	8 → 59	Interferon regulatory factor 2-binding protein zinc finger	Domain
PF00097	zf-C3HC4	503 → 549	Zinc finger, C3HC4 type (RING finger)	Domain

Sequence

MASVQASRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHV
LPEGRSPGPPALKHPATKDLAAAAAQGPQLPPPQAQPQPSGTGGGVSGQDRYDRATSSGR
LPLPSPALEYTLGSRLANGLGREEAVAEGARRALLGSMPGLMPPGLLAAAVSGLGSRGLT
LAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQLLALSACA
PFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDA
LREPGKALASSGFKYLEYERRHGSGEWRQLGELLTDGVRSFREPAPAEALPQQYPEPAPA
ALCGPPPRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVP
SPIAALKNVAEALGHSPKDPGGGGGPVRAGGASPAASSTAQPPTQHRLVARNGEAEVSPT
AGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQGP
AGEVYCPSGDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERDP

Sequence length

584

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHOLELITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Developmental Disabilities	Developmental disability	Pubtator	37501076, 38091987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	38410879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37501076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	37867141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IRF2BP1 (interferon regulatory factor 2 binding protein 1)