Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26137
Gene name	Zinc finger and BTB domain containing 20
Gene symbol	ZBTB20
Synonyms (NCBI Gene)	DPZFHOFODA-8SPRIMSZNF288
Chromosome	3
Chromosome location	3q13.31
Summary	This gene, which was initially designated as dendritic cell-derived BTB/POZ zinc finger (DPZF), belongs to a family of transcription factors with an N-terminal BTB/POZ domain and a C-terminal DNA-bindng zinc finger domain. The BTB/POZ domain is a hydropho

Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs150263896	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs483353063	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs483353068	C>G,T	Not-provided, pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs483353069	T>G	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs483353070	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs879255635	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1064795382	T>C	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1560092224	T>A,C	Pathogenic, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1560092633	A>G	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1576220405	T>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1576220750	A>G	Pathogenic, likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1576220876	G>A	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1576220938	T>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1576220959	G>A	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant

324

Show/Hide all (324)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018364	hsa-miR-335-5p	Microarray	18185580
MIRT029806	hsa-miR-26b-5p	Microarray	19088304
MIRT030905	hsa-miR-21-5p	Microarray	18591254
MIRT047281	hsa-miR-181b-5p	CLASH	23622248
MIRT519999	hsa-miR-8485	HITS-CLIP	21572407
MIRT519998	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT519997	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT519996	hsa-miR-603	HITS-CLIP	21572407
MIRT519994	hsa-miR-3941	HITS-CLIP	21572407
MIRT519992	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT519993	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT641783	hsa-miR-217	HITS-CLIP	23824327
MIRT641782	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT607531	hsa-miR-8064	HITS-CLIP	23824327
MIRT606907	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT639848	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT639847	hsa-miR-4286	HITS-CLIP	23824327
MIRT639846	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT639845	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT639844	hsa-miR-5193	HITS-CLIP	23824327
MIRT639843	hsa-miR-4287	HITS-CLIP	23824327
MIRT639842	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639841	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639840	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT639839	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639838	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639837	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606907	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	24906430
MIRT606911	hsa-miR-4302	HITS-CLIP	24906430
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	24906430
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606908	hsa-miR-4672	HITS-CLIP	24906430
MIRT606907	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT607531	hsa-miR-8064	HITS-CLIP	24906430
MIRT606907	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	24906430
MIRT606911	hsa-miR-4302	HITS-CLIP	24906430
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	24906430
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606908	hsa-miR-4672	HITS-CLIP	24906430
MIRT606907	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT519998	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT519997	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT520000	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT519999	hsa-miR-8485	PAR-CLIP	21572407
MIRT552636	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT519995	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT519993	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520000	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT519999	hsa-miR-8485	PAR-CLIP	23446348
MIRT519998	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT519997	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT519996	hsa-miR-603	PAR-CLIP	23446348
MIRT519995	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT519994	hsa-miR-3941	PAR-CLIP	23446348
MIRT519992	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT519993	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT498027	hsa-miR-144-3p	PAR-CLIP	22291592
MIRT498026	hsa-miR-27a-3p	PAR-CLIP	22291592
MIRT498025	hsa-miR-216a-3p	PAR-CLIP	22291592
MIRT498024	hsa-miR-27b-3p	PAR-CLIP	22291592
MIRT498023	hsa-miR-3681-3p	PAR-CLIP	22291592
MIRT498022	hsa-miR-128-3p	PAR-CLIP	22291592
MIRT498021	hsa-miR-5590-3p	PAR-CLIP	22291592
MIRT498020	hsa-miR-142-5p	PAR-CLIP	22291592
MIRT498019	hsa-miR-340-5p	PAR-CLIP	22291592
MIRT498018	hsa-miR-548a-3p	PAR-CLIP	22291592
MIRT498017	hsa-miR-548ar-3p	PAR-CLIP	22291592
MIRT498016	hsa-miR-548az-3p	PAR-CLIP	22291592
MIRT498015	hsa-miR-548e-3p	PAR-CLIP	22291592
MIRT498014	hsa-miR-548f-3p	PAR-CLIP	22291592
MIRT498013	hsa-miR-5582-3p	PAR-CLIP	22291592
MIRT498012	hsa-miR-548a-5p	PAR-CLIP	22291592
MIRT498011	hsa-miR-548ab	PAR-CLIP	22291592
MIRT498010	hsa-miR-548ad-5p	PAR-CLIP	22291592
MIRT498009	hsa-miR-548ae-5p	PAR-CLIP	22291592
MIRT498008	hsa-miR-548ak	PAR-CLIP	22291592
MIRT498007	hsa-miR-548am-5p	PAR-CLIP	22291592
MIRT498006	hsa-miR-548ap-5p	PAR-CLIP	22291592
MIRT498005	hsa-miR-548aq-5p	PAR-CLIP	22291592
MIRT498004	hsa-miR-548ar-5p	PAR-CLIP	22291592
MIRT498003	hsa-miR-548as-5p	PAR-CLIP	22291592
MIRT498002	hsa-miR-548au-5p	PAR-CLIP	22291592
MIRT498001	hsa-miR-548ay-5p	PAR-CLIP	22291592
MIRT498000	hsa-miR-548b-5p	PAR-CLIP	22291592
MIRT497999	hsa-miR-548bb-5p	PAR-CLIP	22291592
MIRT497998	hsa-miR-548c-5p	PAR-CLIP	22291592
MIRT497997	hsa-miR-548d-5p	PAR-CLIP	22291592
MIRT497996	hsa-miR-548h-5p	PAR-CLIP	22291592
MIRT497995	hsa-miR-548i	PAR-CLIP	22291592
MIRT497994	hsa-miR-548j-5p	PAR-CLIP	22291592
MIRT497993	hsa-miR-548o-5p	PAR-CLIP	22291592
MIRT497992	hsa-miR-548w	PAR-CLIP	22291592
MIRT497991	hsa-miR-548y	PAR-CLIP	22291592
MIRT497990	hsa-miR-559	PAR-CLIP	22291592
MIRT497989	hsa-miR-548av-5p	PAR-CLIP	22291592
MIRT497988	hsa-miR-548k	PAR-CLIP	22291592
MIRT497987	hsa-miR-8054	PAR-CLIP	22291592
MIRT497986	hsa-miR-548l	PAR-CLIP	22291592
MIRT497985	hsa-miR-577	PAR-CLIP	22291592
MIRT497984	hsa-miR-4696	PAR-CLIP	22291592
MIRT497983	hsa-miR-513a-5p	PAR-CLIP	22291592
MIRT448301	hsa-miR-29a-5p	PAR-CLIP	22100165
MIRT448300	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448299	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448298	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT448297	hsa-miR-578	PAR-CLIP	22100165
MIRT448301	hsa-miR-29a-5p	PAR-CLIP	22100165
MIRT448300	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448299	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448298	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT448297	hsa-miR-578	PAR-CLIP	22100165
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	27418678
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	27418678
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	27418678
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	27418678
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	27418678
MIRT606908	hsa-miR-4672	HITS-CLIP	27418678
MIRT606908	hsa-miR-4672	HITS-CLIP	27418678
MIRT606908	hsa-miR-4672	HITS-CLIP	27418678
MIRT606908	hsa-miR-4672	HITS-CLIP	27418678
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	27418678
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	27418678
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	27418678
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	27418678
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607531	hsa-miR-8064	HITS-CLIP	27418678
MIRT519999	hsa-miR-8485	HITS-CLIP	21572407
MIRT519998	hsa-miR-329-3p	HITS-CLIP	21572407
MIRT519997	hsa-miR-362-3p	HITS-CLIP	21572407
MIRT519996	hsa-miR-603	HITS-CLIP	21572407
MIRT519994	hsa-miR-3941	HITS-CLIP	21572407
MIRT519992	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT519993	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT641783	hsa-miR-217	HITS-CLIP	23824327
MIRT641782	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT607531	hsa-miR-8064	HITS-CLIP	23824327
MIRT606907	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT639848	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT639847	hsa-miR-4286	HITS-CLIP	23824327
MIRT639846	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT639845	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT639844	hsa-miR-5193	HITS-CLIP	23824327
MIRT639843	hsa-miR-4287	HITS-CLIP	23824327
MIRT639842	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639841	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT639840	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT639839	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639838	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639837	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606912	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT606910	hsa-miR-3177-5p	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606908	hsa-miR-4672	HITS-CLIP	23824327
MIRT606909	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT606907	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT519998	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT519997	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT520000	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT519999	hsa-miR-8485	PAR-CLIP	21572407
MIRT552636	hsa-miR-5580-3p	PAR-CLIP	21572407
MIRT519995	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT519993	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520000	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT519999	hsa-miR-8485	PAR-CLIP	23446348
MIRT519998	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT519997	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT519996	hsa-miR-603	PAR-CLIP	23446348
MIRT519995	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT519994	hsa-miR-3941	PAR-CLIP	23446348
MIRT519992	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT519993	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT498027	hsa-miR-144-3p	PAR-CLIP	22291592
MIRT498026	hsa-miR-27a-3p	PAR-CLIP	22291592
MIRT498025	hsa-miR-216a-3p	PAR-CLIP	22291592
MIRT498024	hsa-miR-27b-3p	PAR-CLIP	22291592
MIRT498023	hsa-miR-3681-3p	PAR-CLIP	22291592
MIRT498022	hsa-miR-128-3p	PAR-CLIP	22291592
MIRT498021	hsa-miR-5590-3p	PAR-CLIP	22291592
MIRT498020	hsa-miR-142-5p	PAR-CLIP	22291592
MIRT498019	hsa-miR-340-5p	PAR-CLIP	22291592
MIRT498018	hsa-miR-548a-3p	PAR-CLIP	22291592
MIRT498017	hsa-miR-548ar-3p	PAR-CLIP	22291592
MIRT498016	hsa-miR-548az-3p	PAR-CLIP	22291592
MIRT498015	hsa-miR-548e-3p	PAR-CLIP	22291592
MIRT498014	hsa-miR-548f-3p	PAR-CLIP	22291592
MIRT498013	hsa-miR-5582-3p	PAR-CLIP	22291592
MIRT498012	hsa-miR-548a-5p	PAR-CLIP	22291592
MIRT498011	hsa-miR-548ab	PAR-CLIP	22291592
MIRT498010	hsa-miR-548ad-5p	PAR-CLIP	22291592
MIRT498009	hsa-miR-548ae-5p	PAR-CLIP	22291592
MIRT498008	hsa-miR-548ak	PAR-CLIP	22291592
MIRT498007	hsa-miR-548am-5p	PAR-CLIP	22291592
MIRT498006	hsa-miR-548ap-5p	PAR-CLIP	22291592
MIRT498005	hsa-miR-548aq-5p	PAR-CLIP	22291592
MIRT498004	hsa-miR-548ar-5p	PAR-CLIP	22291592
MIRT498003	hsa-miR-548as-5p	PAR-CLIP	22291592
MIRT498002	hsa-miR-548au-5p	PAR-CLIP	22291592
MIRT498001	hsa-miR-548ay-5p	PAR-CLIP	22291592
MIRT498000	hsa-miR-548b-5p	PAR-CLIP	22291592
MIRT497999	hsa-miR-548bb-5p	PAR-CLIP	22291592
MIRT497998	hsa-miR-548c-5p	PAR-CLIP	22291592
MIRT497997	hsa-miR-548d-5p	PAR-CLIP	22291592
MIRT497996	hsa-miR-548h-5p	PAR-CLIP	22291592
MIRT497995	hsa-miR-548i	PAR-CLIP	22291592
MIRT497994	hsa-miR-548j-5p	PAR-CLIP	22291592
MIRT497993	hsa-miR-548o-5p	PAR-CLIP	22291592
MIRT497992	hsa-miR-548w	PAR-CLIP	22291592
MIRT497991	hsa-miR-548y	PAR-CLIP	22291592
MIRT497990	hsa-miR-559	PAR-CLIP	22291592
MIRT497989	hsa-miR-548av-5p	PAR-CLIP	22291592
MIRT497988	hsa-miR-548k	PAR-CLIP	22291592
MIRT497987	hsa-miR-8054	PAR-CLIP	22291592
MIRT497986	hsa-miR-548l	PAR-CLIP	22291592
MIRT497985	hsa-miR-577	PAR-CLIP	22291592
MIRT497984	hsa-miR-4696	PAR-CLIP	22291592
MIRT497983	hsa-miR-513a-5p	PAR-CLIP	22291592
MIRT448301	hsa-miR-29a-5p	PAR-CLIP	22100165
MIRT448300	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448299	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448298	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT448297	hsa-miR-578	PAR-CLIP	22100165
MIRT448301	hsa-miR-29a-5p	PAR-CLIP	22100165
MIRT448300	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448299	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT448298	hsa-miR-4762-3p	PAR-CLIP	22100165
MIRT448297	hsa-miR-578	PAR-CLIP	22100165
MIRT755757	hsa-miR-200a-3p	Luciferase reporter assayqRT-PCRRNA-seq	38869276
MIRT1502097	hsa-miR-4311	CLIP-seq
MIRT2664806	hsa-miR-1224-3p	CLIP-seq
MIRT2664807	hsa-miR-1245b-5p	CLIP-seq
MIRT2664808	hsa-miR-1260	CLIP-seq
MIRT2664809	hsa-miR-1260b	CLIP-seq
MIRT2664810	hsa-miR-1280	CLIP-seq
MIRT2664811	hsa-miR-129-3p	CLIP-seq
MIRT2664812	hsa-miR-129-5p	CLIP-seq
MIRT2664813	hsa-miR-141	CLIP-seq
MIRT2664814	hsa-miR-142-3p	CLIP-seq
MIRT2664815	hsa-miR-188-3p	CLIP-seq
MIRT2664816	hsa-miR-200a	CLIP-seq
MIRT2664817	hsa-miR-2276	CLIP-seq
MIRT2664818	hsa-miR-3142	CLIP-seq
MIRT2664819	hsa-miR-3156-3p	CLIP-seq
MIRT2664820	hsa-miR-3674	CLIP-seq
MIRT2664821	hsa-miR-371-3p	CLIP-seq
MIRT2664822	hsa-miR-371b-3p	CLIP-seq
MIRT2664823	hsa-miR-4473	CLIP-seq
MIRT2664824	hsa-miR-4645-3p	CLIP-seq
MIRT2664825	hsa-miR-4760-5p	CLIP-seq
MIRT2664826	hsa-miR-494	CLIP-seq
MIRT2664827	hsa-miR-512-3p	CLIP-seq
MIRT2664828	hsa-miR-515-3p	CLIP-seq
MIRT2664829	hsa-miR-519e	CLIP-seq
MIRT2664830	hsa-miR-520f	CLIP-seq
MIRT2664831	hsa-miR-548u	CLIP-seq
MIRT2664832	hsa-miR-938	CLIP-seq
MIRT2664806	hsa-miR-1224-3p	CLIP-seq
MIRT2664807	hsa-miR-1245b-5p	CLIP-seq
MIRT2664808	hsa-miR-1260	CLIP-seq
MIRT2664809	hsa-miR-1260b	CLIP-seq
MIRT2664810	hsa-miR-1280	CLIP-seq
MIRT2664811	hsa-miR-129-3p	CLIP-seq
MIRT2664812	hsa-miR-129-5p	CLIP-seq
MIRT2664813	hsa-miR-141	CLIP-seq
MIRT2664814	hsa-miR-142-3p	CLIP-seq
MIRT2664815	hsa-miR-188-3p	CLIP-seq
MIRT2664816	hsa-miR-200a	CLIP-seq
MIRT2664817	hsa-miR-2276	CLIP-seq
MIRT2664818	hsa-miR-3142	CLIP-seq
MIRT2664819	hsa-miR-3156-3p	CLIP-seq
MIRT2664820	hsa-miR-3674	CLIP-seq
MIRT2664821	hsa-miR-371-3p	CLIP-seq
MIRT2664822	hsa-miR-371b-3p	CLIP-seq
MIRT2695466	hsa-miR-412	CLIP-seq
MIRT2695467	hsa-miR-4457	CLIP-seq
MIRT2664823	hsa-miR-4473	CLIP-seq
MIRT2664824	hsa-miR-4645-3p	CLIP-seq
MIRT2664825	hsa-miR-4760-5p	CLIP-seq
MIRT2664826	hsa-miR-494	CLIP-seq
MIRT2664827	hsa-miR-512-3p	CLIP-seq
MIRT2695468	hsa-miR-513b	CLIP-seq
MIRT2664828	hsa-miR-515-3p	CLIP-seq
MIRT2664829	hsa-miR-519e	CLIP-seq
MIRT2664830	hsa-miR-520f	CLIP-seq
MIRT2664831	hsa-miR-548u	CLIP-seq
MIRT2664832	hsa-miR-938	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0045821	Process	Positive regulation of glycolytic process	IEA
GO:0045821	Process	Positive regulation of glycolytic process	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	ISS
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
606025	13503	ENSG00000181722

Q9HC78

Protein name

Zinc finger and BTB domain-containing protein 20 (Dendritic-derived BTB/POZ zinc finger protein) (Zinc finger protein 288)

Protein function

May be a transcription factor that may be involved in hematopoiesis, oncogenesis, and immune responses (PubMed:11352661). Plays a role in postnatal myogenesis, may be involved in the regulation of satellite cells self-renewal (By similarity). {E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	94 → 197	BTB/POZ domain	Domain
PF00096	zf-C2H2	578 → 600	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	606 → 628	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	634 → 656	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	662 → 684	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	715 → 737	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen, lymph node, thymus, peripheral blood leukocytes, and fetal liver. {ECO:0000269|PubMed:11352661}.

Sequence

MLERKKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPDPALIHSTHSLTNSHA
HTGSSDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRC
VLAAGSPFFQDKLLLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASIL
QIKTVIDECTRIVSQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSV
DRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMER
YLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDT
DQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGPGAARDSQAEPTQPEQAAEAPAEGG
PQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQT
ETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFV
TVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVH
TGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEK
SYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVC
PAKFDQIEQFNDHMRMHVSDG

Sequence length

741

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal facial shape	Likely pathogenic	rs1560092224	RCV000710049	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autistic behavior	Likely pathogenic	rs1560092224	RCV000710049	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clinodactyly of the 4th toe	Likely pathogenic	rs1560092224	RCV000710049	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clinodactyly of the 5th finger	Likely pathogenic	rs1560092224	RCV000710049	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Likely pathogenic; Pathogenic	rs2108202536, rs1576220938, rs1576280892, rs1576288424	RCV002273868 RCV001260847 RCV001260820 RCV001260835	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Marfanoid habitus and intellectual disability	Likely pathogenic; Pathogenic	rs1576220750	RCV000850409	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Moderate global developmental delay	Likely pathogenic	rs1560092224	RCV000710049	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs1240860015, rs1576220750	RCV002277708 RCV003389185	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primrose syndrome	Likely pathogenic; Pathogenic	rs2108083606, rs2108207488, rs2108200372, rs483353064, rs483353065, rs483353066, rs483353067, rs483353068, rs483353069, rs483353070, rs483353063, rs2108202121, rs1576220938, rs2079589483, rs1196823355 View all (18 more)	RCV002285175 RCV001542527 RCV001824014 RCV000133615 RCV000149432 View all (30 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SHORT syndrome	Likely pathogenic; Pathogenic	rs1057519435	RCV005863135	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ZBTB20-related disorder	Pathogenic; Likely pathogenic	rs1331926530, rs2550438573	RCV004754880 RCV003899830	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (38)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL MUCINOUS ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY-CATARACTS-CALCIFIED PINNAE-MYOPATHY SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-OPERATIVE ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (103)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	29942513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANONYCHIA	Anonychia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	38102312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31170943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23032108	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	23032108		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic behavior	Autism	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autistic Disorder	Autism	BEFREE	25062845, 30281617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	30217971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33275231, 35589867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31556767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21702992, 32319639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cognition Disorders	Cognition disorder	Pubtator	34285142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	29942513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Mucinous Adenocarcinoma	Colorectal Cancer	GWASCAT_DG	29942513		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	29942513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	27061120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	22180640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30637921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Distal amyotrophy	Distal amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	19273596, 21567911, 22180640, 23032108, 25017102, 27061120, 28462983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	32238402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27646774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26176862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27646774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28327662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28327662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30099442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40348204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30099442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31170943, 35309316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	22180640, 23920044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	22037551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hip Contracture	Hip Contracture	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27061120, 30281617		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	34285142	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability-cataracts-calcified pinnae-myopathy syndrome	Intellectual Disability-Cataracts-Calcified Pinnae-Myopathy Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal disease	Pubtator	28220687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31539138, 37585722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31539138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21702992, 26893361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25311537	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26176862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	32238402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	24694013		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30217971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27646774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	29942513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21216289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	28319090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	22037551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	GWASDB_DG	22037551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23861218, 27127881, 31556767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	29942513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25062845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21654638, 26893361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	25062845, 30281617		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25311537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Plagiocephaly	Plagiocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Platybasia	Platybasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primrose syndrome	Primrose Syndrome	GENOMICS_ENGLAND_DG	20644156, 25017102		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primrose syndrome	Primrose Syndrome	BEFREE	25017102, 27061120, 29681083, 29737001, 30637921, 31321892, 31821719		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primrose syndrome	Primrose Syndrome	CTD_human_DG	25017102		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primrose syndrome	Primrose Syndrome	UNIPROT_DG	25017102		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primrose syndrome	Primrose Syndrome	ORPHANET_DG	25017102		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Primrose syndrome	Primrose Syndrome	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	28319090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	22037555		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	30217971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28327662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	GWASCAT_DG	22037551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23861218, 27127881, 31556767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	22037551		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	26176862, 27127881, 28220687, 31556767, 32936247	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Synophrys	Synophrys	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	25062845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	24694013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	30217971		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZBTB20 (zinc finger and BTB domain containing 20)