Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26122
Gene name	Enhancer of polycomb 2
Gene symbol	EPC2
Synonyms (NCBI Gene)	EPC-LIKE
Chromosome	2
Chromosome location	2q23.1

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT085668	hsa-miR-194-5p	PAR-CLIP	21572407
MIRT085676	hsa-miR-5692a	PAR-CLIP	21572407
MIRT085671	hsa-miR-802	PAR-CLIP	21572407
MIRT085677	hsa-miR-5692b	PAR-CLIP	21572407
MIRT085675	hsa-miR-5692c	PAR-CLIP	21572407
MIRT558083	hsa-miR-4272	PAR-CLIP	21572407
MIRT558082	hsa-miR-5697	PAR-CLIP	21572407
MIRT447801	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447800	hsa-miR-3662	PAR-CLIP	22100165
MIRT203708	hsa-miR-944	PAR-CLIP	22100165
MIRT447799	hsa-miR-499a-3p	PAR-CLIP	22100165
MIRT447798	hsa-miR-499b-3p	PAR-CLIP	22100165
MIRT447797	hsa-miR-4635	PAR-CLIP	22100165
MIRT447796	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT447795	hsa-miR-4452	PAR-CLIP	22100165
MIRT085668	hsa-miR-194-5p	PAR-CLIP	21572407
MIRT085676	hsa-miR-5692a	PAR-CLIP	21572407
MIRT085671	hsa-miR-802	PAR-CLIP	21572407
MIRT085677	hsa-miR-5692b	PAR-CLIP	21572407
MIRT085675	hsa-miR-5692c	PAR-CLIP	21572407
MIRT558083	hsa-miR-4272	PAR-CLIP	21572407
MIRT558082	hsa-miR-5697	PAR-CLIP	21572407
MIRT447801	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447800	hsa-miR-3662	PAR-CLIP	22100165
MIRT203708	hsa-miR-944	PAR-CLIP	22100165
MIRT447799	hsa-miR-499a-3p	PAR-CLIP	22100165
MIRT447798	hsa-miR-499b-3p	PAR-CLIP	22100165
MIRT447797	hsa-miR-4635	PAR-CLIP	22100165
MIRT447796	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT447795	hsa-miR-4452	PAR-CLIP	22100165
MIRT965941	hsa-miR-1207-3p	CLIP-seq
MIRT965942	hsa-miR-1245	CLIP-seq
MIRT965943	hsa-miR-1279	CLIP-seq
MIRT965944	hsa-miR-1286	CLIP-seq
MIRT965945	hsa-miR-1290	CLIP-seq
MIRT965946	hsa-miR-1297	CLIP-seq
MIRT965947	hsa-miR-130a	CLIP-seq
MIRT965948	hsa-miR-130b	CLIP-seq
MIRT965949	hsa-miR-186	CLIP-seq
MIRT965950	hsa-miR-196a	CLIP-seq
MIRT965951	hsa-miR-196b	CLIP-seq
MIRT965952	hsa-miR-19a	CLIP-seq
MIRT965953	hsa-miR-19b	CLIP-seq
MIRT965954	hsa-miR-224	CLIP-seq
MIRT965955	hsa-miR-26a	CLIP-seq
MIRT965956	hsa-miR-26b	CLIP-seq
MIRT965957	hsa-miR-301a	CLIP-seq
MIRT965958	hsa-miR-301b	CLIP-seq
MIRT965959	hsa-miR-3065-3p	CLIP-seq
MIRT965960	hsa-miR-30a	CLIP-seq
MIRT965961	hsa-miR-30b	CLIP-seq
MIRT965962	hsa-miR-30c	CLIP-seq
MIRT965963	hsa-miR-30d	CLIP-seq
MIRT965964	hsa-miR-30e	CLIP-seq
MIRT965965	hsa-miR-3133	CLIP-seq
MIRT965966	hsa-miR-3152-5p	CLIP-seq
MIRT965967	hsa-miR-3163	CLIP-seq
MIRT965968	hsa-miR-3167	CLIP-seq
MIRT965969	hsa-miR-33a	CLIP-seq
MIRT965970	hsa-miR-33b	CLIP-seq
MIRT965971	hsa-miR-3591-3p	CLIP-seq
MIRT965972	hsa-miR-3614-3p	CLIP-seq
MIRT965973	hsa-miR-3659	CLIP-seq
MIRT965974	hsa-miR-3664-5p	CLIP-seq
MIRT965975	hsa-miR-3666	CLIP-seq
MIRT965976	hsa-miR-3676	CLIP-seq
MIRT965977	hsa-miR-3942-3p	CLIP-seq
MIRT965978	hsa-miR-4282	CLIP-seq
MIRT965979	hsa-miR-4295	CLIP-seq
MIRT965980	hsa-miR-4312	CLIP-seq
MIRT965981	hsa-miR-4328	CLIP-seq
MIRT965982	hsa-miR-433	CLIP-seq
MIRT965983	hsa-miR-4422	CLIP-seq
MIRT965984	hsa-miR-4423-5p	CLIP-seq
MIRT965985	hsa-miR-4446-5p	CLIP-seq
MIRT965986	hsa-miR-4465	CLIP-seq
MIRT965987	hsa-miR-4470	CLIP-seq
MIRT965988	hsa-miR-4494	CLIP-seq
MIRT965989	hsa-miR-4495	CLIP-seq
MIRT965990	hsa-miR-450b-5p	CLIP-seq
MIRT965991	hsa-miR-4517	CLIP-seq
MIRT965992	hsa-miR-454	CLIP-seq
MIRT965993	hsa-miR-4661-3p	CLIP-seq
MIRT965994	hsa-miR-4668-3p	CLIP-seq
MIRT965995	hsa-miR-4676-5p	CLIP-seq
MIRT965996	hsa-miR-4677-3p	CLIP-seq
MIRT965997	hsa-miR-4679	CLIP-seq
MIRT965998	hsa-miR-4684-3p	CLIP-seq
MIRT965999	hsa-miR-4698	CLIP-seq
MIRT966000	hsa-miR-4704-5p	CLIP-seq
MIRT966001	hsa-miR-4722-5p	CLIP-seq
MIRT966002	hsa-miR-4755-5p	CLIP-seq
MIRT966003	hsa-miR-4766-5p	CLIP-seq
MIRT966004	hsa-miR-4774-3p	CLIP-seq
MIRT966005	hsa-miR-4797-5p	CLIP-seq
MIRT966006	hsa-miR-494	CLIP-seq
MIRT966007	hsa-miR-495	CLIP-seq
MIRT966008	hsa-miR-499a-5p	CLIP-seq
MIRT966009	hsa-miR-507	CLIP-seq
MIRT966010	hsa-miR-5096	CLIP-seq
MIRT966011	hsa-miR-518a-5p	CLIP-seq
MIRT966012	hsa-miR-519a	CLIP-seq
MIRT966013	hsa-miR-519b-3p	CLIP-seq
MIRT966014	hsa-miR-519c-3p	CLIP-seq
MIRT966015	hsa-miR-520d-5p	CLIP-seq
MIRT966016	hsa-miR-524-5p	CLIP-seq
MIRT966017	hsa-miR-527	CLIP-seq
MIRT966018	hsa-miR-543	CLIP-seq
MIRT966019	hsa-miR-557	CLIP-seq
MIRT966020	hsa-miR-575	CLIP-seq
MIRT966021	hsa-miR-582-5p	CLIP-seq
MIRT966022	hsa-miR-590-3p	CLIP-seq
MIRT966023	hsa-miR-600	CLIP-seq
MIRT966024	hsa-miR-624	CLIP-seq
MIRT966025	hsa-miR-640	CLIP-seq
MIRT966026	hsa-miR-670	CLIP-seq
MIRT966027	hsa-miR-759	CLIP-seq
MIRT966028	hsa-miR-876-5p	CLIP-seq
MIRT965943	hsa-miR-1279	CLIP-seq
MIRT965954	hsa-miR-224	CLIP-seq
MIRT965959	hsa-miR-3065-3p	CLIP-seq
MIRT1986110	hsa-miR-323b-3p	CLIP-seq
MIRT1986111	hsa-miR-337-3p	CLIP-seq
MIRT1986112	hsa-miR-3545-3p	CLIP-seq
MIRT965976	hsa-miR-3676	CLIP-seq
MIRT1986113	hsa-miR-3685	CLIP-seq
MIRT1986114	hsa-miR-384	CLIP-seq
MIRT965980	hsa-miR-4312	CLIP-seq
MIRT1986115	hsa-miR-4501	CLIP-seq
MIRT1986116	hsa-miR-4645-3p	CLIP-seq
MIRT1986117	hsa-miR-4652-3p	CLIP-seq
MIRT966009	hsa-miR-507	CLIP-seq
MIRT1986118	hsa-miR-514	CLIP-seq
MIRT1986119	hsa-miR-514b-3p	CLIP-seq
MIRT1986120	hsa-miR-548l	CLIP-seq
MIRT966019	hsa-miR-557	CLIP-seq
MIRT966021	hsa-miR-582-5p	CLIP-seq
MIRT2220666	hsa-miR-1272	CLIP-seq
MIRT965943	hsa-miR-1279	CLIP-seq
MIRT2220667	hsa-miR-194	CLIP-seq
MIRT965959	hsa-miR-3065-3p	CLIP-seq
MIRT2220668	hsa-miR-3153	CLIP-seq
MIRT965967	hsa-miR-3163	CLIP-seq
MIRT965971	hsa-miR-3591-3p	CLIP-seq
MIRT965976	hsa-miR-3676	CLIP-seq
MIRT2220669	hsa-miR-3682-3p	CLIP-seq
MIRT965980	hsa-miR-4312	CLIP-seq
MIRT965981	hsa-miR-4328	CLIP-seq
MIRT965983	hsa-miR-4422	CLIP-seq
MIRT2220670	hsa-miR-493	CLIP-seq
MIRT966006	hsa-miR-494	CLIP-seq
MIRT965959	hsa-miR-3065-3p	CLIP-seq
MIRT965976	hsa-miR-3676	CLIP-seq
MIRT965988	hsa-miR-4494	CLIP-seq
MIRT966000	hsa-miR-4704-5p	CLIP-seq
MIRT2220670	hsa-miR-493	CLIP-seq
MIRT966008	hsa-miR-499a-5p	CLIP-seq
MIRT966021	hsa-miR-582-5p	CLIP-seq
MIRT966023	hsa-miR-600	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IDA	27153538
GO:0005634	Component	Nucleus	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0032777	Component	Piccolo histone acetyltransferase complex	IBA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IDA	27153538
GO:0035267	Component	NuA4 histone acetyltransferase complex	IEA
GO:0042981	Process	Regulation of apoptotic process	NAS	14966270
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	27153538
GO:0051726	Process	Regulation of cell cycle	IMP	27153538
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	27153538
GO:2000779	Process	Regulation of double-strand break repair	NAS	14966270

MIM	HGNC	e!Ensembl
611000	24543	ENSG00000135999

Q52LR7

Protein name

Enhancer of polycomb homolog 2 (EPC-like)

Protein function

May play a role in transcription or DNA repair.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10513	EPL1	7 → 149	Enhancer of polycomb-like	Family
PF06752	E_Pc_C	577 → 807	Enhancer of Polycomb C-terminus	Family

Sequence

MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAIS
AQQVFREKKESMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSE
DETLLNRLNRKMEIKPLQFEIMIDRLEKASSNQLVTLQEAKLLLNEDDYLIKAVYDYWVR
KRKNCRGPSLIPQIKQEKRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRE
FSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGGEILNEVKISRSEKELYATPA
TLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVI
NKSDIKQYDFHSSDEDEFPQVLSPVSEPEEENDPDGPCAFRRRAGCQYYAPRLDQANHSC
ENSELADLDKLRYRHCLTTLTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPEM
LNSFSSSSQTIDFSSNFSRTNASSKHCENRLSLSEILSNIRSCRLQCFQPRLLNLQDSDS
EECTSRKPGQTVNNKRVSAASVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQ
LQQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASAHFAASAVVSAPVPSRSEVAKEQNT
GHNNINGVVQPSGTSKTLYSTNMALSSSPGISAVQLVRTVGHTTTNHLIPALCTSSPQTL
PMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRVPKVTPSSAIS
SIARENHEPERLGLNGIAETTVAMEVT

Sequence length

807

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26297437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30841855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21123754	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	22085900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29086334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	BEFREE	28104354, 29729938, 31647967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29086334, 30841855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30578870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	19809484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24166297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24166297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 29483656, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe intellectual disability	Mental retardation	BEFREE	19809484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20042640, 28764725		★★★★★ ★☆☆☆☆ Found in Text Mining only

EPC2 (enhancer of polycomb 2)