Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26052
Gene name	Dynamin 3
Gene symbol	DNM3
Synonyms (NCBI Gene)	Dyna III
Chromosome	1
Chromosome location	1q24.3
Summary	This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing resu

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022316	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT032198	hsa-let-7b-5p	Proteomics	18668040
MIRT942403	hsa-miR-1237	CLIP-seq
MIRT942404	hsa-miR-1248	CLIP-seq
MIRT942405	hsa-miR-1278	CLIP-seq
MIRT942406	hsa-miR-1297	CLIP-seq
MIRT942407	hsa-miR-26a	CLIP-seq
MIRT942408	hsa-miR-26b	CLIP-seq
MIRT942409	hsa-miR-3686	CLIP-seq
MIRT942410	hsa-miR-410	CLIP-seq
MIRT942411	hsa-miR-4432	CLIP-seq
MIRT942412	hsa-miR-4465	CLIP-seq
MIRT942413	hsa-miR-4672	CLIP-seq
MIRT942414	hsa-miR-4719	CLIP-seq
MIRT942415	hsa-miR-4742-3p	CLIP-seq
MIRT942416	hsa-miR-4778-3p	CLIP-seq
MIRT942417	hsa-miR-570	CLIP-seq
MIRT942418	hsa-miR-579	CLIP-seq
MIRT942405	hsa-miR-1278	CLIP-seq
MIRT942406	hsa-miR-1297	CLIP-seq
MIRT942407	hsa-miR-26a	CLIP-seq
MIRT942408	hsa-miR-26b	CLIP-seq
MIRT942419	hsa-miR-3137	CLIP-seq
MIRT942420	hsa-miR-3165	CLIP-seq
MIRT942421	hsa-miR-3182	CLIP-seq
MIRT942422	hsa-miR-3529	CLIP-seq
MIRT942423	hsa-miR-3653	CLIP-seq
MIRT942424	hsa-miR-3658	CLIP-seq
MIRT942425	hsa-miR-3682-5p	CLIP-seq
MIRT942409	hsa-miR-3686	CLIP-seq
MIRT942426	hsa-miR-379	CLIP-seq
MIRT942427	hsa-miR-3925-3p	CLIP-seq
MIRT942428	hsa-miR-4257	CLIP-seq
MIRT942429	hsa-miR-4307	CLIP-seq
MIRT942430	hsa-miR-4451	CLIP-seq
MIRT942431	hsa-miR-4456	CLIP-seq
MIRT942412	hsa-miR-4465	CLIP-seq
MIRT942432	hsa-miR-4477a	CLIP-seq
MIRT942433	hsa-miR-4517	CLIP-seq
MIRT942434	hsa-miR-4650-3p	CLIP-seq
MIRT942435	hsa-miR-4699-3p	CLIP-seq
MIRT942436	hsa-miR-520a-5p	CLIP-seq
MIRT942437	hsa-miR-525-5p	CLIP-seq
MIRT942438	hsa-miR-576-3p	CLIP-seq
MIRT942439	hsa-miR-766	CLIP-seq
MIRT1979018	hsa-miR-128	CLIP-seq
MIRT1979019	hsa-miR-3074-3p	CLIP-seq
MIRT1979020	hsa-miR-515-5p	CLIP-seq
MIRT1979021	hsa-miR-548p	CLIP-seq
MIRT2214161	hsa-miR-4729	CLIP-seq
MIRT2214162	hsa-miR-499-3p	CLIP-seq
MIRT2214163	hsa-miR-499a-3p	CLIP-seq
MIRT2214164	hsa-miR-513a-5p	CLIP-seq
MIRT2214165	hsa-miR-1292	CLIP-seq
MIRT2214166	hsa-miR-132	CLIP-seq
MIRT2214167	hsa-miR-212	CLIP-seq
MIRT2214168	hsa-miR-300	CLIP-seq
MIRT2214169	hsa-miR-381	CLIP-seq
MIRT2214170	hsa-miR-4328	CLIP-seq
MIRT2214171	hsa-miR-4471	CLIP-seq
MIRT2214172	hsa-miR-4646-5p	CLIP-seq
MIRT2214173	hsa-miR-4666-3p	CLIP-seq
MIRT2214174	hsa-miR-4774-5p	CLIP-seq
MIRT2214175	hsa-miR-548g	CLIP-seq
MIRT2214176	hsa-miR-587	CLIP-seq
MIRT2387049	hsa-miR-3691-5p	CLIP-seq
MIRT2442113	hsa-miR-142-5p	CLIP-seq
MIRT2442114	hsa-miR-340	CLIP-seq
MIRT2518528	hsa-miR-105	CLIP-seq
MIRT2518529	hsa-miR-140-3p	CLIP-seq
MIRT2518530	hsa-miR-148a	CLIP-seq
MIRT2518531	hsa-miR-148b	CLIP-seq
MIRT2518532	hsa-miR-152	CLIP-seq
MIRT2518533	hsa-miR-299-3p	CLIP-seq
MIRT2518534	hsa-miR-3129-3p	CLIP-seq
MIRT2518535	hsa-miR-3136-5p	CLIP-seq
MIRT2518536	hsa-miR-3153	CLIP-seq
MIRT2518537	hsa-miR-4439	CLIP-seq
MIRT2518538	hsa-miR-4513	CLIP-seq
MIRT2518539	hsa-miR-4648	CLIP-seq
MIRT2518540	hsa-miR-4654	CLIP-seq
MIRT2518541	hsa-miR-4662a-5p	CLIP-seq
MIRT2518542	hsa-miR-4666-5p	CLIP-seq
MIRT2518543	hsa-miR-4668-5p	CLIP-seq
MIRT2518544	hsa-miR-4769-5p	CLIP-seq
MIRT2518545	hsa-miR-4789-3p	CLIP-seq
MIRT2518546	hsa-miR-4793-5p	CLIP-seq
MIRT2518547	hsa-miR-556-3p	CLIP-seq
MIRT2518548	hsa-miR-943	CLIP-seq
MIRT2679374	hsa-miR-3185	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TWIST1	Activation	18033314

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0005515	Function	Protein binding	IPI	15252009
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	ISS
GO:0007416	Process	Synapse assembly	ISS
GO:0008017	Function	Microtubule binding	IBA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016185	Process	Synaptic vesicle budding from presynaptic endocytic zone membrane	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	26302298
GO:0043197	Component	Dendritic spine	ISS
GO:0045202	Component	Synapse	IBA
GO:0046847	Process	Filopodium assembly	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098793	Component	Presynapse	IEA

MIM	HGNC	e!Ensembl
611445	29125	ENSG00000197959

Q9UQ16

Protein name

Dynamin-3 (EC 3.6.5.5) (Dynamin, testicular) (T-dynamin)

Protein function

Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes, in particular endocytosis (By similarity).

PDB

3L43 , 5A3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00350	Dynamin_N	34 → 207	Dynamin family	Domain
PF01031	Dynamin_M	216 → 502	Dynamin central region	Family
PF00169	PH	526 → 630	PH domain	Domain
PF02212	GED	654 → 745	Dynamin GTPase effector domain	Family

Sequence

MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIM
KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVE
TIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAE
QAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRP
TLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR
APPSVPSRRPPPSPTRPTIIRPLESSLLD

Sequence length

869

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Endocytosis Synaptic vesicle cycle Endocrine and other factor-regulated calcium reabsorption Bacterial invasion of epithelial cells		Toll Like Receptor 4 (TLR4) Cascade MHC class II antigen presentation Recycling pathway of L1 Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOPHYTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	27993161, 33499882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26784388	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32573516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21548129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30349300, 31388312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24440977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29449895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29449895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27837435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22297481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	33141070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21117066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26784388, 28599479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21383689, 30349300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30349300, 31388312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37380766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	36400759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21383689, 28599479, 31388312, 31572010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24673776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29145611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29145611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	27023174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29145611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29145611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	30557369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34027641, 36528667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31572010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29473656, 30133089, 30340792, 31041581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27692902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33622874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	31249589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	18033314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	18033314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	26930587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26784388	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	31249589		★★★★★ ★☆☆☆☆ Found in Text Mining only

DNM3 (dynamin 3)