Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26027
Gene name	Acyl-CoA thioesterase 11
Gene symbol	ACOT11
Synonyms (NCBI Gene)	BFITSTARD14THEATHEM1
Chromosome	1
Chromosome location	1p32.3
Summary	This gene encodes a member of the acyl-CoA thioesterase family which catalyse the conversion of activated fatty acids to the corresponding non-esterified fatty acid and coenzyme A. Expression of a mouse homolog in brown adipose tissue is induced by low te

Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022706	hsa-miR-124-3p	Microarray	18668037
MIRT762866	hsa-miR-1205	CLIP-seq
MIRT762867	hsa-miR-221	CLIP-seq
MIRT762868	hsa-miR-222	CLIP-seq
MIRT762869	hsa-miR-3922-5p	CLIP-seq
MIRT762870	hsa-miR-4708-3p	CLIP-seq
MIRT762871	hsa-miR-4742-5p	CLIP-seq
MIRT1924883	hsa-miR-4501	CLIP-seq
MIRT2166090	hsa-miR-3940-5p	CLIP-seq
MIRT2166091	hsa-miR-4507	CLIP-seq
MIRT2166092	hsa-miR-548a-3p	CLIP-seq
MIRT2166093	hsa-miR-548e	CLIP-seq
MIRT2166094	hsa-miR-548f	CLIP-seq
MIRT2166095	hsa-miR-563	CLIP-seq
MIRT2468624	hsa-miR-1260	CLIP-seq
MIRT2468625	hsa-miR-1260b	CLIP-seq
MIRT2468626	hsa-miR-1827	CLIP-seq
MIRT2468627	hsa-miR-188-3p	CLIP-seq
MIRT2468628	hsa-miR-3156-3p	CLIP-seq
MIRT2468629	hsa-miR-3612	CLIP-seq
MIRT2468630	hsa-miR-650	CLIP-seq
MIRT2468631	hsa-miR-662	CLIP-seq
MIRT2468632	hsa-miR-940	CLIP-seq
MIRT2468624	hsa-miR-1260	CLIP-seq
MIRT2468625	hsa-miR-1260b	CLIP-seq
MIRT2468626	hsa-miR-1827	CLIP-seq
MIRT2468627	hsa-miR-188-3p	CLIP-seq
MIRT2468628	hsa-miR-3156-3p	CLIP-seq
MIRT2468629	hsa-miR-3612	CLIP-seq
MIRT2468630	hsa-miR-650	CLIP-seq
MIRT2468631	hsa-miR-662	CLIP-seq
MIRT2468632	hsa-miR-940	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	22897136
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	22897136
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	NAS	11696000
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009266	Process	Response to temperature stimulus	ISS
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	ISS	11696000
GO:0016787	Function	Hydrolase activity	IEA
GO:0016790	Function	Thiolester hydrolase activity	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	11696000
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IDA	22897136
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	TAS	11696000
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IBA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	22897136
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	27110486

MIM	HGNC	e!Ensembl
606803	18156	ENSG00000162390

Q8WXI4

Protein name

Acyl-coenzyme A thioesterase 11 (Acyl-CoA thioesterase 11) (EC 3.1.2.-) (Acyl-CoA thioester hydrolase 11) (Adipose-associated thioesterase) (Brown fat-inducible thioesterase) (BFIT) (Palmitoyl-coenzyme A thioesterase) (EC 3.1.2.2)

Protein function

Has an acyl-CoA thioesterase activity with a preference for the long chain fatty acyl-CoA thioesters hexadecanoyl-CoA/palmitoyl-CoA and tetradecanoyl-CoA/myristoyl-CoA which are the main substrates in the mitochondrial beta-oxidation pathway. {E

PDB

3FO5 , 6VVQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03061	4HBT	62 → 135	Thioesterase superfamily	Domain
PF03061	4HBT	234 → 309	Thioesterase superfamily	Domain
PF01852	START	384 → 590	START domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is predominantly expressed in skeletal muscle, liver, testis, stomach, spleen, lung and brain. Isoform 2 is predominantly expressed in kidney, uterus, hibernoma and white adipose tissue.

Sequence

MIQNVGNHLRRGLASVFSNRTSRKSALRAGNDSAMADGEGYRNPTEVQMSQLVLPCHTNQ
RGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFN
SSMEVGIQVASEDLCSEKQWNVCKALATFVARREITKVKLKQITPRTEEEKMEHSVAAER
RRMRLVYADTIKDLLANCAIQGDLESRDCSRMVPAEKTRVESVELVLPPHANHQGNTFGG
QIMAWMENVATIAASRLCRAHPTLKAIEMFHFRGPSQVGDRLVLKAIVNNAFKHSMEVGV
CVEAYRQEAETHRRHINSAFMTFVVLDADDQPQLLPWIRPQPGDGERRYREASARKKIRL
DRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLED
DKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALG
GHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQ
LTKCCWVRVSLTELVSASGFYSWGLESRSKGRRSDGWNGKLAGGHLSTLKAIPVAKINSR
FGYLQDT

Sequence length

607

Interactions

View interactions

	Reactome
			Mitochondrial Fatty Acid Beta-Oxidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28927126	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	GWASDB_DG	19578366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28589894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28589894	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	GWASDB_DG	19578366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21788354	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12168561	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24223798	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11696000	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	28545978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29208699	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31137010	★★★★★ ★☆☆☆☆ Found in Text Mining only

ACOT11 (acyl-CoA thioesterase 11)