Gene Gene information from NCBI Gene database.
Entrez ID 26022
Gene name Transmembrane protein 98
Gene symbol TMEM98
Synonyms (NCBI Gene)
TADA1
Chromosome 17
Chromosome location 17q11.2
Summary This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs587777690 G>C,T Pathogenic Coding sequence variant, missense variant
rs869312733 A>C Pathogenic Missense variant, coding sequence variant
rs869312734 AGAATGAAGACTGGATCGAAGATGCCTCGTAAGG>- Pathogenic Coding sequence variant, splice donor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
163
miRTarBase ID miRNA Experiments Reference
MIRT044487 hsa-miR-320a CLASH 23622248
MIRT044487 hsa-miR-320a CLASH 23622248
MIRT043661 hsa-miR-342-3p CLASH 23622248
MIRT042183 hsa-miR-484 CLASH 23622248
MIRT344723 hsa-miR-577 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IDA 25946230
GO:0005615 Component Extracellular space IEA
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615949 24529 ENSG00000006042
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y2Y6
Protein name Transmembrane protein 98 (Protein TADA1)
Protein function Functions as a negative regulator of MYRF in oligodendrocyte differentiation and myelination. Interacts with the C-terminal of MYRF inhibiting MYRF self-cleavage and N-fragment nuclear translocation. The secreted form promotes differentiation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13324 GCIP 41 170 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high expression in the ovary, pancreas and prostate (PubMed:25946230). Expressed in the eye, particularly in corneal endothelium, iris, ciliary body, sclera, optic nerve, optic nerve head, and retina (PubMed:24852
Sequence
METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPS
ELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMK
TSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLV
LVTRNACHLT
GGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI
Sequence length 226
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Nanophthalmos 4 Pathogenic rs587777690, rs869312733, rs869312734 RCV000143786
RCV000210025
RCV000209982
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NANOPHTHALMOS Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 1 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 2 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 3 Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aicardi Goutieres syndrome Aicardi goutieres syndrome Pubtator 32996714 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 29152140
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 29152140
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 26884835, 29152140
★☆☆☆☆
Found in Text Mining only
Glaucoma Glaucoma HPO_DG
★☆☆☆☆
Found in Text Mining only
Hyperopia Hyperopia Pubtator 33203948 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 24608572
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 26884835 Inhibit
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 26884835, 29152140
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 26884835
★☆☆☆☆
Found in Text Mining only