Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26022
Gene name	Transmembrane protein 98
Gene symbol	TMEM98
Synonyms (NCBI Gene)	TADA1
Chromosome	17
Chromosome location	17q11.2
Summary	This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777690	G>C,T	Pathogenic	Coding sequence variant, missense variant
rs869312733	A>C	Pathogenic	Missense variant, coding sequence variant
rs869312734	AGAATGAAGACTGGATCGAAGATGCCTCGTAAGG>-	Pathogenic	Coding sequence variant, splice donor variant, intron variant

163

Show/Hide all (163)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044487	hsa-miR-320a	CLASH	23622248
MIRT044487	hsa-miR-320a	CLASH	23622248
MIRT043661	hsa-miR-342-3p	CLASH	23622248
MIRT042183	hsa-miR-484	CLASH	23622248
MIRT344723	hsa-miR-577	HITS-CLIP	19536157
MIRT560531	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT560530	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT560529	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT560528	hsa-miR-641	PAR-CLIP	20371350
MIRT560527	hsa-miR-302f	PAR-CLIP	20371350
MIRT560526	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT560525	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT560524	hsa-miR-5702	PAR-CLIP	20371350
MIRT560523	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560522	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT560521	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT560520	hsa-miR-937-5p	PAR-CLIP	20371350
MIRT560519	hsa-miR-627-5p	PAR-CLIP	20371350
MIRT560518	hsa-miR-33a-5p	PAR-CLIP	20371350
MIRT560517	hsa-miR-33b-5p	PAR-CLIP	20371350
MIRT560516	hsa-miR-8081	PAR-CLIP	20371350
MIRT344723	hsa-miR-577	HITS-CLIP	19536157
MIRT560531	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT560530	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT560529	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT560528	hsa-miR-641	PAR-CLIP	20371350
MIRT560527	hsa-miR-302f	PAR-CLIP	20371350
MIRT560526	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT560525	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT560524	hsa-miR-5702	PAR-CLIP	20371350
MIRT560523	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT560522	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT560521	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT560520	hsa-miR-937-5p	PAR-CLIP	20371350
MIRT560519	hsa-miR-627-5p	PAR-CLIP	20371350
MIRT560518	hsa-miR-33a-5p	PAR-CLIP	20371350
MIRT560517	hsa-miR-33b-5p	PAR-CLIP	20371350
MIRT560516	hsa-miR-8081	PAR-CLIP	20371350
MIRT1439807	hsa-miR-1207-5p	CLIP-seq
MIRT1439808	hsa-miR-1909	CLIP-seq
MIRT1439809	hsa-miR-205	CLIP-seq
MIRT1439810	hsa-miR-4467	CLIP-seq
MIRT1439811	hsa-miR-4685-5p	CLIP-seq
MIRT1439812	hsa-miR-4763-3p	CLIP-seq
MIRT1439813	hsa-miR-1305	CLIP-seq
MIRT1439814	hsa-miR-4328	CLIP-seq
MIRT1439815	hsa-miR-455-3p	CLIP-seq
MIRT2353003	hsa-miR-2355-3p	CLIP-seq
MIRT2353004	hsa-miR-3182	CLIP-seq
MIRT2353005	hsa-miR-3647-3p	CLIP-seq
MIRT2353006	hsa-miR-3909	CLIP-seq
MIRT2353007	hsa-miR-4766-5p	CLIP-seq
MIRT2353008	hsa-miR-676	CLIP-seq
MIRT2646609	hsa-miR-1183	CLIP-seq
MIRT1439807	hsa-miR-1207-5p	CLIP-seq
MIRT2646610	hsa-miR-1226	CLIP-seq
MIRT1439813	hsa-miR-1305	CLIP-seq
MIRT2646611	hsa-miR-151-3p	CLIP-seq
MIRT1439808	hsa-miR-1909	CLIP-seq
MIRT2646612	hsa-miR-1976	CLIP-seq
MIRT1439809	hsa-miR-205	CLIP-seq
MIRT2646613	hsa-miR-22	CLIP-seq
MIRT2646614	hsa-miR-24	CLIP-seq
MIRT2646615	hsa-miR-2467-3p	CLIP-seq
MIRT2646616	hsa-miR-3148	CLIP-seq
MIRT2646617	hsa-miR-3154	CLIP-seq
MIRT2646618	hsa-miR-3176	CLIP-seq
MIRT2646619	hsa-miR-320e	CLIP-seq
MIRT2646620	hsa-miR-3678-3p	CLIP-seq
MIRT2646621	hsa-miR-370	CLIP-seq
MIRT2646622	hsa-miR-3922-3p	CLIP-seq
MIRT2646623	hsa-miR-3925-3p	CLIP-seq
MIRT2646624	hsa-miR-4252	CLIP-seq
MIRT2646625	hsa-miR-4284	CLIP-seq
MIRT1439814	hsa-miR-4328	CLIP-seq
MIRT2646626	hsa-miR-4434	CLIP-seq
MIRT2646627	hsa-miR-4463	CLIP-seq
MIRT1439810	hsa-miR-4467	CLIP-seq
MIRT2646628	hsa-miR-4496	CLIP-seq
MIRT2646629	hsa-miR-4499	CLIP-seq
MIRT2646630	hsa-miR-450b-5p	CLIP-seq
MIRT2646631	hsa-miR-4516	CLIP-seq
MIRT2646632	hsa-miR-4531	CLIP-seq
MIRT2646633	hsa-miR-4539	CLIP-seq
MIRT1439815	hsa-miR-455-3p	CLIP-seq
MIRT2646634	hsa-miR-4635	CLIP-seq
MIRT2646635	hsa-miR-4637	CLIP-seq
MIRT2646636	hsa-miR-4642	CLIP-seq
MIRT2646637	hsa-miR-4645-3p	CLIP-seq
MIRT2646638	hsa-miR-4663	CLIP-seq
MIRT2646639	hsa-miR-4680-5p	CLIP-seq
MIRT1439811	hsa-miR-4685-5p	CLIP-seq
MIRT2646640	hsa-miR-4691-3p	CLIP-seq
MIRT2646641	hsa-miR-4733-3p	CLIP-seq
MIRT1439812	hsa-miR-4763-3p	CLIP-seq
MIRT2646642	hsa-miR-483-5p	CLIP-seq
MIRT2646643	hsa-miR-501-3p	CLIP-seq
MIRT2646644	hsa-miR-502-3p	CLIP-seq
MIRT2646645	hsa-miR-526b	CLIP-seq
MIRT2646646	hsa-miR-542-5p	CLIP-seq
MIRT2646647	hsa-miR-548g	CLIP-seq
MIRT2646648	hsa-miR-548n	CLIP-seq
MIRT2646649	hsa-miR-570	CLIP-seq
MIRT2646650	hsa-miR-578	CLIP-seq
MIRT2646651	hsa-miR-583	CLIP-seq
MIRT2646652	hsa-miR-618	CLIP-seq
MIRT2646653	hsa-miR-766	CLIP-seq
MIRT2646654	hsa-miR-891b	CLIP-seq
MIRT2646609	hsa-miR-1183	CLIP-seq
MIRT1439807	hsa-miR-1207-5p	CLIP-seq
MIRT2646610	hsa-miR-1226	CLIP-seq
MIRT1439813	hsa-miR-1305	CLIP-seq
MIRT2646611	hsa-miR-151-3p	CLIP-seq
MIRT1439808	hsa-miR-1909	CLIP-seq
MIRT2646612	hsa-miR-1976	CLIP-seq
MIRT1439809	hsa-miR-205	CLIP-seq
MIRT2646613	hsa-miR-22	CLIP-seq
MIRT2646614	hsa-miR-24	CLIP-seq
MIRT2646615	hsa-miR-2467-3p	CLIP-seq
MIRT2646616	hsa-miR-3148	CLIP-seq
MIRT2646617	hsa-miR-3154	CLIP-seq
MIRT2646618	hsa-miR-3176	CLIP-seq
MIRT2646619	hsa-miR-320e	CLIP-seq
MIRT2646620	hsa-miR-3678-3p	CLIP-seq
MIRT2646621	hsa-miR-370	CLIP-seq
MIRT2646622	hsa-miR-3922-3p	CLIP-seq
MIRT2646623	hsa-miR-3925-3p	CLIP-seq
MIRT2646624	hsa-miR-4252	CLIP-seq
MIRT2646625	hsa-miR-4284	CLIP-seq
MIRT1439814	hsa-miR-4328	CLIP-seq
MIRT2646626	hsa-miR-4434	CLIP-seq
MIRT2646627	hsa-miR-4463	CLIP-seq
MIRT1439810	hsa-miR-4467	CLIP-seq
MIRT2646628	hsa-miR-4496	CLIP-seq
MIRT2646629	hsa-miR-4499	CLIP-seq
MIRT2646630	hsa-miR-450b-5p	CLIP-seq
MIRT2646631	hsa-miR-4516	CLIP-seq
MIRT2646632	hsa-miR-4531	CLIP-seq
MIRT2646633	hsa-miR-4539	CLIP-seq
MIRT1439815	hsa-miR-455-3p	CLIP-seq
MIRT2646634	hsa-miR-4635	CLIP-seq
MIRT2646635	hsa-miR-4637	CLIP-seq
MIRT2646636	hsa-miR-4642	CLIP-seq
MIRT2646637	hsa-miR-4645-3p	CLIP-seq
MIRT2646638	hsa-miR-4663	CLIP-seq
MIRT2646639	hsa-miR-4680-5p	CLIP-seq
MIRT1439811	hsa-miR-4685-5p	CLIP-seq
MIRT2646640	hsa-miR-4691-3p	CLIP-seq
MIRT2693578	hsa-miR-4693-3p	CLIP-seq
MIRT2646641	hsa-miR-4733-3p	CLIP-seq
MIRT1439812	hsa-miR-4763-3p	CLIP-seq
MIRT2646642	hsa-miR-483-5p	CLIP-seq
MIRT2646643	hsa-miR-501-3p	CLIP-seq
MIRT2646644	hsa-miR-502-3p	CLIP-seq
MIRT2646645	hsa-miR-526b	CLIP-seq
MIRT2646646	hsa-miR-542-5p	CLIP-seq
MIRT2646647	hsa-miR-548g	CLIP-seq
MIRT2646648	hsa-miR-548n	CLIP-seq
MIRT2646650	hsa-miR-578	CLIP-seq
MIRT2646651	hsa-miR-583	CLIP-seq
MIRT2646652	hsa-miR-618	CLIP-seq
MIRT2646653	hsa-miR-766	CLIP-seq
MIRT2646654	hsa-miR-891b	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	25946230
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IDA	25946230
GO:0005886	Component	Plasma membrane	IEA
GO:0010955	Process	Negative regulation of protein processing	IEA
GO:0016020	Component	Membrane	IEA
GO:0031642	Process	Negative regulation of myelination	IEA
GO:0031642	Process	Negative regulation of myelination	ISS
GO:0045063	Process	T-helper 1 cell differentiation	IEA
GO:0045063	Process	T-helper 1 cell differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0070062	Component	Extracellular exosome	IDA	25946230
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA

MIM	HGNC	e!Ensembl
615949	24529	ENSG00000006042

Q9Y2Y6

Protein name

Transmembrane protein 98 (Protein TADA1)

Protein function

Functions as a negative regulator of MYRF in oligodendrocyte differentiation and myelination. Interacts with the C-terminal of MYRF inhibiting MYRF self-cleavage and N-fragment nuclear translocation. The secreted form promotes differentiation of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13324	GCIP	41 → 170		Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with high expression in the ovary, pancreas and prostate (PubMed:25946230). Expressed in the eye, particularly in corneal endothelium, iris, ciliary body, sclera, optic nerve, optic nerve head, and retina (PubMed:24852

Sequence

METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPS
ELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMK
TSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLT
GGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI

Sequence length

226

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nanophthalmos 4	Pathogenic	rs587777690, rs869312733, rs869312734	RCV000143786 RCV000210025 RCV000209982	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NANOPHTHALMOS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TMEM98-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	32996714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29152140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29152140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26884835, 29152140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	Pubtator	33203948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24608572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26884835	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26884835, 29152140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26884835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	ORPHANET_DG	24852644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	26392740, 31266059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	32052405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nanophthalmos	Nanophthalmos	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nanophthalmos 1	Nanophthalmos	Pubtator	26392740, 32052405, 33004036, 33203948	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NANOPHTHALMOS 4	Nanophthalmos	UNIPROT_DG	24852644, 26392740		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NANOPHTHALMOS 4	Nanophthalmos	GENOMICS_ENGLAND_DG	26392740		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NANOPHTHALMOS 4	Nanophthalmos	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NANOPHTHALMOS 4	Nanophthalmos	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasms	Neoplasms	BEFREE	24608572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35866395	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	24362369		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24362369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM98 (transmembrane protein 98)