Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26018
Gene name	Leucine rich repeats and immunoglobulin like domains 1
Gene symbol	LRIG1
Synonyms (NCBI Gene)	LIG-1LIG1
Chromosome	3
Chromosome location	3p14.1

329

Show/Hide all (329)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022896	hsa-miR-124-3p	Microarray	18668037
MIRT024575	hsa-miR-215-5p	Microarray	19074876
MIRT026719	hsa-miR-192-5p	Microarray	19074876
MIRT027745	hsa-miR-98-5p	Microarray	19088304
MIRT049649	hsa-miR-92a-3p	CLASH	23622248
MIRT045526	hsa-miR-149-5p	CLASH	23622248
MIRT054124	hsa-let-7b-5p	Luciferase reporter assayMicroarrayqRT-PCR	22995917
MIRT656648	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT656647	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT656645	hsa-miR-5193	HITS-CLIP	23824327
MIRT656646	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT656644	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT656643	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT656642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656641	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT656640	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT656639	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT641461	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT641460	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT641459	hsa-miR-545-5p	HITS-CLIP	23824327
MIRT641457	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT641458	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT641456	hsa-miR-4287	HITS-CLIP	23824327
MIRT641455	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT641454	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT641453	hsa-miR-3926	HITS-CLIP	23824327
MIRT641452	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT641451	hsa-miR-548s	HITS-CLIP	23824327
MIRT641450	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT641449	hsa-miR-588	HITS-CLIP	23824327
MIRT641448	hsa-miR-4435	HITS-CLIP	23824327
MIRT641447	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT308266	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT440314	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440314	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT656648	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT656647	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT656645	hsa-miR-5193	HITS-CLIP	23824327
MIRT656646	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT656644	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT656643	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT656642	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT656641	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT656640	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT656639	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT641461	hsa-miR-208a-5p	HITS-CLIP	23824327
MIRT641460	hsa-miR-208b-5p	HITS-CLIP	23824327
MIRT641459	hsa-miR-545-5p	HITS-CLIP	23824327
MIRT641457	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT641458	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT641456	hsa-miR-4287	HITS-CLIP	23824327
MIRT641455	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT641454	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT641453	hsa-miR-3926	HITS-CLIP	23824327
MIRT641452	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT641451	hsa-miR-548s	HITS-CLIP	23824327
MIRT641450	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT641449	hsa-miR-588	HITS-CLIP	23824327
MIRT641448	hsa-miR-4435	HITS-CLIP	23824327
MIRT641447	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT308266	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT1117607	hsa-miR-1238	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT1117609	hsa-miR-1252	CLIP-seq
MIRT1117610	hsa-miR-1271	CLIP-seq
MIRT1117611	hsa-miR-145	CLIP-seq
MIRT1117612	hsa-miR-15a	CLIP-seq
MIRT1117613	hsa-miR-15b	CLIP-seq
MIRT1117614	hsa-miR-16	CLIP-seq
MIRT1117615	hsa-miR-182	CLIP-seq
MIRT1117616	hsa-miR-195	CLIP-seq
MIRT1117617	hsa-miR-2113	CLIP-seq
MIRT1117618	hsa-miR-23a	CLIP-seq
MIRT1117619	hsa-miR-23b	CLIP-seq
MIRT1117620	hsa-miR-23c	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT1117622	hsa-miR-3152-5p	CLIP-seq
MIRT1117623	hsa-miR-3180-5p	CLIP-seq
MIRT1117624	hsa-miR-3622b-5p	CLIP-seq
MIRT1117625	hsa-miR-3646	CLIP-seq
MIRT1117626	hsa-miR-424	CLIP-seq
MIRT1117627	hsa-miR-425	CLIP-seq
MIRT1117628	hsa-miR-4267	CLIP-seq
MIRT1117629	hsa-miR-4317	CLIP-seq
MIRT1117630	hsa-miR-4328	CLIP-seq
MIRT1117631	hsa-miR-4330	CLIP-seq
MIRT1117632	hsa-miR-4426	CLIP-seq
MIRT1117633	hsa-miR-4470	CLIP-seq
MIRT1117634	hsa-miR-4520a-3p	CLIP-seq
MIRT1117635	hsa-miR-4528	CLIP-seq
MIRT1117636	hsa-miR-4647	CLIP-seq
MIRT1117637	hsa-miR-4650-5p	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT1117639	hsa-miR-4662b	CLIP-seq
MIRT1117640	hsa-miR-4675	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT1117642	hsa-miR-4741	CLIP-seq
MIRT1117643	hsa-miR-4765	CLIP-seq
MIRT1117644	hsa-miR-497	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT1117646	hsa-miR-516a-3p	CLIP-seq
MIRT1117647	hsa-miR-545	CLIP-seq
MIRT1117648	hsa-miR-548ad	CLIP-seq
MIRT1117649	hsa-miR-570	CLIP-seq
MIRT1117650	hsa-miR-642b	CLIP-seq
MIRT1117651	hsa-miR-96	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT1117609	hsa-miR-1252	CLIP-seq
MIRT2033247	hsa-miR-2053	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT2033248	hsa-miR-3622a-3p	CLIP-seq
MIRT2033249	hsa-miR-3622b-3p	CLIP-seq
MIRT2033250	hsa-miR-3660	CLIP-seq
MIRT2033251	hsa-miR-3942-3p	CLIP-seq
MIRT2033252	hsa-miR-4264	CLIP-seq
MIRT2033253	hsa-miR-4526	CLIP-seq
MIRT2033254	hsa-miR-4645-3p	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT1117643	hsa-miR-4765	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT1117609	hsa-miR-1252	CLIP-seq
MIRT2263569	hsa-miR-1273g	CLIP-seq
MIRT2263570	hsa-miR-1305	CLIP-seq
MIRT2263571	hsa-miR-1324	CLIP-seq
MIRT1117611	hsa-miR-145	CLIP-seq
MIRT1117612	hsa-miR-15a	CLIP-seq
MIRT1117613	hsa-miR-15b	CLIP-seq
MIRT1117614	hsa-miR-16	CLIP-seq
MIRT2263572	hsa-miR-1914	CLIP-seq
MIRT1117616	hsa-miR-195	CLIP-seq
MIRT2263573	hsa-miR-200b	CLIP-seq
MIRT2263574	hsa-miR-200c	CLIP-seq
MIRT2033247	hsa-miR-2053	CLIP-seq
MIRT1117617	hsa-miR-2113	CLIP-seq
MIRT1117618	hsa-miR-23a	CLIP-seq
MIRT1117619	hsa-miR-23b	CLIP-seq
MIRT1117620	hsa-miR-23c	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT1117622	hsa-miR-3152-5p	CLIP-seq
MIRT1117623	hsa-miR-3180-5p	CLIP-seq
MIRT2263575	hsa-miR-3190	CLIP-seq
MIRT2263576	hsa-miR-323b-5p	CLIP-seq
MIRT2263577	hsa-miR-3591-3p	CLIP-seq
MIRT2033248	hsa-miR-3622a-3p	CLIP-seq
MIRT2033249	hsa-miR-3622b-3p	CLIP-seq
MIRT2033250	hsa-miR-3660	CLIP-seq
MIRT2263578	hsa-miR-3714	CLIP-seq
MIRT1117626	hsa-miR-424	CLIP-seq
MIRT2033252	hsa-miR-4264	CLIP-seq
MIRT1117628	hsa-miR-4267	CLIP-seq
MIRT2263579	hsa-miR-4282	CLIP-seq
MIRT2263580	hsa-miR-429	CLIP-seq
MIRT1117629	hsa-miR-4317	CLIP-seq
MIRT1117630	hsa-miR-4328	CLIP-seq
MIRT1117631	hsa-miR-4330	CLIP-seq
MIRT2263581	hsa-miR-4446-3p	CLIP-seq
MIRT2263582	hsa-miR-4477a	CLIP-seq
MIRT2033253	hsa-miR-4526	CLIP-seq
MIRT2033254	hsa-miR-4645-3p	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT2263583	hsa-miR-4666-5p	CLIP-seq
MIRT2263584	hsa-miR-4668-3p	CLIP-seq
MIRT1117640	hsa-miR-4675	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT1117642	hsa-miR-4741	CLIP-seq
MIRT2263585	hsa-miR-4752	CLIP-seq
MIRT1117643	hsa-miR-4765	CLIP-seq
MIRT2263586	hsa-miR-4802-3p	CLIP-seq
MIRT1117644	hsa-miR-497	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT2263587	hsa-miR-513a-3p	CLIP-seq
MIRT1117646	hsa-miR-516a-3p	CLIP-seq
MIRT1117647	hsa-miR-545	CLIP-seq
MIRT2263588	hsa-miR-548c-3p	CLIP-seq
MIRT2263589	hsa-miR-548n	CLIP-seq
MIRT2263590	hsa-miR-548t	CLIP-seq
MIRT2263591	hsa-miR-548u	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT1117610	hsa-miR-1271	CLIP-seq
MIRT1117627	hsa-miR-425	CLIP-seq
MIRT1117632	hsa-miR-4426	CLIP-seq
MIRT1117636	hsa-miR-4647	CLIP-seq
MIRT1117639	hsa-miR-4662b	CLIP-seq
MIRT1117650	hsa-miR-642b	CLIP-seq
MIRT1117651	hsa-miR-96	CLIP-seq
MIRT2562864	hsa-miR-106a	CLIP-seq
MIRT2562865	hsa-miR-106b	CLIP-seq
MIRT1117607	hsa-miR-1238	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT2562866	hsa-miR-1253	CLIP-seq
MIRT1117610	hsa-miR-1271	CLIP-seq
MIRT2562867	hsa-miR-130a	CLIP-seq
MIRT2562868	hsa-miR-130b	CLIP-seq
MIRT1117611	hsa-miR-145	CLIP-seq
MIRT2562869	hsa-miR-17	CLIP-seq
MIRT2562870	hsa-miR-1912	CLIP-seq
MIRT2562871	hsa-miR-19a	CLIP-seq
MIRT2562872	hsa-miR-19b	CLIP-seq
MIRT2033247	hsa-miR-2053	CLIP-seq
MIRT2562873	hsa-miR-20a	CLIP-seq
MIRT2562874	hsa-miR-20b	CLIP-seq
MIRT2562875	hsa-miR-2682	CLIP-seq
MIRT2562876	hsa-miR-301a	CLIP-seq
MIRT2562877	hsa-miR-301b	CLIP-seq
MIRT2562878	hsa-miR-3130-5p	CLIP-seq
MIRT2562879	hsa-miR-3144-3p	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT2562880	hsa-miR-3163	CLIP-seq
MIRT1117623	hsa-miR-3180-5p	CLIP-seq
MIRT2562881	hsa-miR-34a	CLIP-seq
MIRT2562882	hsa-miR-34c-5p	CLIP-seq
MIRT2033248	hsa-miR-3622a-3p	CLIP-seq
MIRT2033249	hsa-miR-3622b-3p	CLIP-seq
MIRT2033250	hsa-miR-3660	CLIP-seq
MIRT2562883	hsa-miR-3666	CLIP-seq
MIRT2263578	hsa-miR-3714	CLIP-seq
MIRT2562884	hsa-miR-371-5p	CLIP-seq
MIRT2562885	hsa-miR-371b-5p	CLIP-seq
MIRT2562886	hsa-miR-4251	CLIP-seq
MIRT2562887	hsa-miR-4256	CLIP-seq
MIRT2033252	hsa-miR-4264	CLIP-seq
MIRT1117628	hsa-miR-4267	CLIP-seq
MIRT2562888	hsa-miR-4295	CLIP-seq
MIRT1117630	hsa-miR-4328	CLIP-seq
MIRT2562889	hsa-miR-4420	CLIP-seq
MIRT1117632	hsa-miR-4426	CLIP-seq
MIRT2263581	hsa-miR-4446-3p	CLIP-seq
MIRT2562890	hsa-miR-4482	CLIP-seq
MIRT2562891	hsa-miR-4493	CLIP-seq
MIRT2562892	hsa-miR-449a	CLIP-seq
MIRT2562893	hsa-miR-449b	CLIP-seq
MIRT2562894	hsa-miR-449c	CLIP-seq
MIRT2033253	hsa-miR-4526	CLIP-seq
MIRT2562895	hsa-miR-454	CLIP-seq
MIRT2033254	hsa-miR-4645-3p	CLIP-seq
MIRT1117636	hsa-miR-4647	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT1117639	hsa-miR-4662b	CLIP-seq
MIRT1117640	hsa-miR-4675	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT2562896	hsa-miR-4717-5p	CLIP-seq
MIRT2562897	hsa-miR-4726-3p	CLIP-seq
MIRT1117642	hsa-miR-4741	CLIP-seq
MIRT1117643	hsa-miR-4765	CLIP-seq
MIRT2562898	hsa-miR-487a	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT1117646	hsa-miR-516a-3p	CLIP-seq
MIRT2562899	hsa-miR-519a	CLIP-seq
MIRT2562900	hsa-miR-519b-3p	CLIP-seq
MIRT2562901	hsa-miR-519c-3p	CLIP-seq
MIRT2562902	hsa-miR-519d	CLIP-seq
MIRT2562903	hsa-miR-548an	CLIP-seq
MIRT2263590	hsa-miR-548t	CLIP-seq
MIRT1117650	hsa-miR-642b	CLIP-seq
MIRT2562904	hsa-miR-765	CLIP-seq
MIRT2562905	hsa-miR-93	CLIP-seq
MIRT1117651	hsa-miR-96	CLIP-seq
MIRT2562864	hsa-miR-106a	CLIP-seq
MIRT2562865	hsa-miR-106b	CLIP-seq
MIRT1117607	hsa-miR-1238	CLIP-seq
MIRT1117608	hsa-miR-1245b-3p	CLIP-seq
MIRT2562866	hsa-miR-1253	CLIP-seq
MIRT1117610	hsa-miR-1271	CLIP-seq
MIRT2562867	hsa-miR-130a	CLIP-seq
MIRT2562868	hsa-miR-130b	CLIP-seq
MIRT1117611	hsa-miR-145	CLIP-seq
MIRT2562869	hsa-miR-17	CLIP-seq
MIRT2562870	hsa-miR-1912	CLIP-seq
MIRT2562871	hsa-miR-19a	CLIP-seq
MIRT2562872	hsa-miR-19b	CLIP-seq
MIRT2562873	hsa-miR-20a	CLIP-seq
MIRT2562874	hsa-miR-20b	CLIP-seq
MIRT2562875	hsa-miR-2682	CLIP-seq
MIRT2562876	hsa-miR-301a	CLIP-seq
MIRT2562877	hsa-miR-301b	CLIP-seq
MIRT2684122	hsa-miR-3124-3p	CLIP-seq
MIRT2562878	hsa-miR-3130-5p	CLIP-seq
MIRT2562879	hsa-miR-3144-3p	CLIP-seq
MIRT1117621	hsa-miR-3145-5p	CLIP-seq
MIRT2562880	hsa-miR-3163	CLIP-seq
MIRT1117623	hsa-miR-3180-5p	CLIP-seq
MIRT2684123	hsa-miR-3183	CLIP-seq
MIRT2562881	hsa-miR-34a	CLIP-seq
MIRT2562882	hsa-miR-34c-5p	CLIP-seq
MIRT2562883	hsa-miR-3666	CLIP-seq
MIRT2263578	hsa-miR-3714	CLIP-seq
MIRT2562884	hsa-miR-371-5p	CLIP-seq
MIRT2562885	hsa-miR-371b-5p	CLIP-seq
MIRT2562886	hsa-miR-4251	CLIP-seq
MIRT1117628	hsa-miR-4267	CLIP-seq
MIRT2562888	hsa-miR-4295	CLIP-seq
MIRT1117632	hsa-miR-4426	CLIP-seq
MIRT2263581	hsa-miR-4446-3p	CLIP-seq
MIRT2562890	hsa-miR-4482	CLIP-seq
MIRT2562891	hsa-miR-4493	CLIP-seq
MIRT2562892	hsa-miR-449a	CLIP-seq
MIRT2562893	hsa-miR-449b	CLIP-seq
MIRT2562894	hsa-miR-449c	CLIP-seq
MIRT2562895	hsa-miR-454	CLIP-seq
MIRT1117636	hsa-miR-4647	CLIP-seq
MIRT1117638	hsa-miR-4653-3p	CLIP-seq
MIRT1117639	hsa-miR-4662b	CLIP-seq
MIRT1117640	hsa-miR-4675	CLIP-seq
MIRT1117641	hsa-miR-4717-3p	CLIP-seq
MIRT2562896	hsa-miR-4717-5p	CLIP-seq
MIRT2684124	hsa-miR-4723-3p	CLIP-seq
MIRT2562897	hsa-miR-4726-3p	CLIP-seq
MIRT1117642	hsa-miR-4741	CLIP-seq
MIRT2684125	hsa-miR-4753-3p	CLIP-seq
MIRT1117643	hsa-miR-4765	CLIP-seq
MIRT2562898	hsa-miR-487a	CLIP-seq
MIRT1117645	hsa-miR-508-5p	CLIP-seq
MIRT1117646	hsa-miR-516a-3p	CLIP-seq
MIRT2562899	hsa-miR-519a	CLIP-seq
MIRT2562900	hsa-miR-519b-3p	CLIP-seq
MIRT2562901	hsa-miR-519c-3p	CLIP-seq
MIRT2562902	hsa-miR-519d	CLIP-seq
MIRT2562903	hsa-miR-548an	CLIP-seq
MIRT2263590	hsa-miR-548t	CLIP-seq
MIRT1117650	hsa-miR-642b	CLIP-seq
MIRT2562904	hsa-miR-765	CLIP-seq
MIRT2562905	hsa-miR-93	CLIP-seq
MIRT1117651	hsa-miR-96	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15282549, 15345710, 18542056, 23723069, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007605	Process	Sensory perception of sound	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0016020	Component	Membrane	IEA
GO:0022405	Process	Hair cycle process	IEA
GO:0032474	Process	Otolith morphogenesis	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0060384	Process	Innervation	IEA

MIM	HGNC	e!Ensembl
608868	17360	ENSG00000144749

Q96JA1

Protein name

Leucine-rich repeats and immunoglobulin-like domains protein 1 (LIG-1)

Protein function

Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.

PDB

4U7L , 4U7M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	70 → 104	Leucine rich repeat	Repeat
PF13855	LRR_8	140 → 189	Leucine rich repeat	Repeat
PF13855	LRR_8	188 → 247	Leucine rich repeat	Repeat
PF13855	LRR_8	307 → 367	Leucine rich repeat	Repeat
PF13855	LRR_8	382 → 442	Leucine rich repeat	Repeat
PF01463	LRRCT	465 → 490	Leucine rich repeat C-terminal domain	Family
PF13927	Ig_3	494 → 581		Domain
PF07679	I-set	599 → 689	Immunoglobulin I-set domain	Domain
PF07679	I-set	693 → 780	Immunoglobulin I-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11414704}.

Sequence

MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLA
ALPGDLPSWTRSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSL
FLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLEL
GAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVL
KLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHR
KGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVL
DLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIF
SVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNA
DMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPS
FTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
DVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLEDRVVSVGETVALQCKATGNP
PPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSV
LPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAG
SAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPS
APNGPEPGGSDQEHSPHHQCSRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGD
SSWTLARLYHPDSTELQPASSLTSGSPERAEAQYLLVSNGHLPKACDASPESTPLTGQLP
GKQRVPLLLAPKS

Sequence length

1093

Interactions

View interactions

	Reactome
			Signaling by EGFR Negative regulation of MET activity

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LRIG1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (124)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23558895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	25353163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	30395541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34151794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	7902391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25449296, 27509922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16978290, 17203305, 21567105, 24314030, 25695283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	8631603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	1881902, 1900268, 2204827, 2767047, 3180052, 3192533, 3479778, 7683758, 7902391, 8254190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16168117, 17178829, 21821674, 22241084, 24879564, 26148232, 28878282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16168117, 21821674, 24879564, 32448168, 34172056, 35440669, 39491279, 40597935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26387542, 38376291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18542056, 20334636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35440669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	38376291	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	34331569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16978290, 17203305, 21567105, 24314030, 25695283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12009232, 16907646, 18709642, 22139380, 24929328, 27352326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	14520461	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22554477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22427941, 24929328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28059143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	GWASCAT_DG	28346443		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	25353163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19779621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30337351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17851870, 26159916, 30248341, 31052457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	21821674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21821674	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33461538, 37357017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35440669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	31297992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14520461		★★★★★ ★☆☆☆☆ Found in Text Mining only
DNA Ligase I Deficiency	DNA Ligase I Deficiency	GENOMICS_ENGLAND_DG	1581963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21750170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18542056, 25449296, 26097540, 29391393, 29793318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18542056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26097540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18542056, 25449296, 25960225, 26097540, 29391393, 29793318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16532360, 19124499, 19421009, 23124613, 23337938, 23581227, 25048475, 25353163, 25449296, 25860915, 25960225, 29391393, 29745084		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	19124499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	19124499, 25048475, 29745084, 37185361	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	25860915	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	GWASCAT_DG	28346443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth Disorders	Growth disorder	Pubtator	26387542	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23624915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	26387542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	GWASCAT_DG	29124443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	25860915	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30487162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	30395541, 39510190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8254190, 8397200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	31826981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29124443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	15016767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18059021, 18709642, 21976407, 22139380, 24929328, 30181552, 37369482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21976407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40269842	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	38460891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28230028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19300910, 23337938, 29391393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23624915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16168117, 17178829, 21821674, 22241084, 24879564, 26148232, 28878282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12009232, 16907646, 18709642, 22139380, 24929328, 27352326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21128282, 31792211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29450946, 30248341, 30320337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29436694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16978290, 17203305, 21567105, 24314030, 25695283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	8631603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11751514, 18059021, 21821674, 22241084, 23558895, 25180912, 26159916, 26632716, 27312791, 28230028, 28259645, 28841699, 28992331, 29317492, 30123358, 30429017 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	26151821, 29917119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30337351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31630206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16168117, 18922900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24879564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	29436694		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30081934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30487162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	22484910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23339595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25180912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11751514, 12234026, 14520461, 15016767, 16168117, 16532360, 16978290, 17851870, 18542056, 21128282, 21567105, 21821674, 23124613, 23337938, 23558895 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16034747, 25563294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25563294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26125914, 26632716, 28230028, 29546323, 30429017		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	25353163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	24548859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34373746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29436694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	27249594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21128282, 31792211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37950047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14520461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	14520461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28059143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	36341401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	25659584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23208928, 29632522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27509922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	31059071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29450946, 30248341, 30320337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29450946, 30320337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29436694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29436694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	2910526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35440669	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36001024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24314030	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32065779, 32579540, 39234248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17624990	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24998916, 26291246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30107825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	25353163		★★★★★ ★☆☆☆☆ Found in Text Mining only

LRIG1 (leucine rich repeats and immunoglobulin like domains 1)