Gene Gene information from NCBI Gene database.
Entrez ID 26003
Gene name Golgi reassembly stacking protein 2
Gene symbol GORASP2
Synonyms (NCBI Gene)
GOLPH6GRASP55GRS2p59
Chromosome 2
Chromosome location 2q31.1
Summary This gene encodes a member of the Golgi reassembly stacking protein family. These proteins may play a role in the stacking of Golgi cisternae and Golgi ribbon formation, as well as Golgi fragmentation during apoptosis or mitosis. The encoded protein also
miRNA miRNA information provided by mirtarbase database.
373
miRTarBase ID miRNA Experiments Reference
MIRT004207 hsa-miR-197-3p Microarray 16822819
MIRT025311 hsa-miR-34a-5p Proteomics 21566225
MIRT052462 hsa-let-7a-5p CLASH 23622248
MIRT051815 hsa-let-7c-5p CLASH 23622248
MIRT050376 hsa-miR-24-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 27062250
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 16189514, 21516116, 21884936, 21900206, 21988832, 24136289, 25416956, 28067262, 29568061, 29892012, 31515488, 32296183, 32814053, 33961781, 35271311, 36012204
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608693 17500 ENSG00000115806
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8Y8
Protein name Golgi reassembly-stacking protein 2 (GRS2) (Golgi phosphoprotein 6) (GOLPH6) (Golgi reassembly-stacking protein of 55 kDa) (GRASP55) (p59)
Protein function Key structural protein of the Golgi apparatus (PubMed:33301566). The membrane cisternae of the Golgi apparatus adhere to each other to form stacks, which are aligned side by side to form the Golgi ribbon (PubMed:33301566). Acting in concert with
PDB 3RLE , 4EDJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04495 GRASP55_65 3 99 GRASP55/65 PDZ-like domain Domain
PF04495 GRASP55_65 71 205 GRASP55/65 PDZ-like domain Domain
Sequence
MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLK
ANVEKPVKML
IYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVES
NSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITP
NSAWGGEGSLGCGIGYGYLHRIPTR
PFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVN
PPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGVPTVPLLPPQVNQSLTSVPPMNPAT
TLPGLMPLPAGLPNLPNLNLNLPAPHIMPGVGLPELVNPGLPPLPSMPPRNLPGIAPLPL
PSEFLPSFPLVPESSSAASSGELLSSLPPTSNAPSDPATTTAKADAASSLTVDVTPPTAK
APTTVEDRVGDSTPVSEKPVSAAVDANASESP
Sequence length 452
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Autophagy - animal   Golgi Cisternae Pericentriolar Stack Reorganization
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCOLIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30899432
★☆☆☆☆
Found in Text Mining only
Appendicitis Appendicitis Pubtator 34103023 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 34069769 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 30655379
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus BEFREE 30655379
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Diabetes mellitus, type 1 Pubtator 34302048, 34997821 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent Diabetes Mellitus BEFREE 30655379
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 23185337, 24893864
★☆☆☆☆
Found in Text Mining only
Endometrial Carcinoma Endometrial carcinoma BEFREE 26498156
★☆☆☆☆
Found in Text Mining only
Glycogen Storage Disease Type II Glycogen storage disease Pubtator 33799647 Associate
★☆☆☆☆
Found in Text Mining only