Gene Gene information from NCBI Gene database.
Entrez ID 25975
Gene name EGF like domain multiple 6
Gene symbol EGFL6
Synonyms (NCBI Gene)
MAEGW80
Chromosome X
Chromosome location Xp22.2
Summary This gene encodes a member of the epidermal growth factor (EGF) repeat superfamily. Members of this superfamily are characterized by the presence of EGF-like repeats and are often involved in the regulation of cell cycle, proliferation, and developmental
miRNA miRNA information provided by mirtarbase database.
8
miRTarBase ID miRNA Experiments Reference
MIRT954704 hsa-miR-142-5p CLIP-seq
MIRT954705 hsa-miR-340 CLIP-seq
MIRT954706 hsa-miR-3671 CLIP-seq
MIRT954707 hsa-miR-4471 CLIP-seq
MIRT954708 hsa-miR-4662a-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005178 Function Integrin binding IEA
GO:0005178 Function Integrin binding TAS 10610727
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300239 3235 ENSG00000198759
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IUX8
Protein name Epidermal growth factor-like protein 6 (EGF-like protein 6) (MAM and EGF domains-containing gene protein)
Protein function May bind integrin alpha-8/beta-1 and play a role in hair follicle morphogenesis. Promotes matrix assembly (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA 94 138 Calcium-binding EGF domain Domain
PF07645 EGF_CA 174 217 Calcium-binding EGF domain Domain
PF07645 EGF_CA 219 259 Calcium-binding EGF domain Domain
PF00629 MAM 402 545 MAM domain, meprin/A5/mu Domain
Sequence
MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTC
AMINCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDC
IDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCS
AIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKAKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRV
FVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLV
SGLCP
DSLLSVDD
Sequence length 553
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Exstrophy-epispadias complex Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 29934389
★☆☆☆☆
Found in Text Mining only
Benign Meningioma Benign Meningioma BEFREE 23285163
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 30455428
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 31196165 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 39187367 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 31516605
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 30395690, 30693973
★☆☆☆☆
Found in Text Mining only
Epithelial ovarian cancer Ovarian cancer BEFREE 31516605
★☆☆☆☆
Found in Text Mining only
Fibrous Meningioma Fibrous Meningioma BEFREE 23285163
★☆☆☆☆
Found in Text Mining only
Hypertrophy Hypertrophy Pubtator 35457174 Associate
★☆☆☆☆
Found in Text Mining only