Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2597
Gene name	Glyceraldehyde-3-phosphate dehydrogenase
Gene symbol	GAPDH
Synonyms (NCBI Gene)	G3PDGAPDHEL-S-162eP
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catal

318

Show/Hide all (318)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001929	hsa-miR-29c-3p	Luciferase reporter assay	18390668
MIRT007162	hsa-miR-644a	Luciferase reporter assayqRT-PCRWestern blot	23091630
MIRT007162	hsa-miR-644a	Luciferase reporter assayqRT-PCRWestern blot	23091630
MIRT052138	hsa-let-7b-5p	CLASH	23622248
MIRT052138	hsa-let-7b-5p	CLASH	23622248
MIRT050952	hsa-miR-17-5p	CLASH	23622248
MIRT050751	hsa-miR-17-3p	CLASH	23622248
MIRT050206	hsa-miR-25-3p	CLASH	23622248
MIRT049457	hsa-miR-92a-3p	CLASH	23622248
MIRT049457	hsa-miR-92a-3p	CLASH	23622248
MIRT048761	hsa-miR-93-5p	CLASH	23622248
MIRT048718	hsa-miR-96-5p	CLASH	23622248
MIRT046276	hsa-miR-23b-3p	CLASH	23622248
MIRT045446	hsa-miR-149-5p	CLASH	23622248
MIRT045446	hsa-miR-149-5p	CLASH	23622248
MIRT045446	hsa-miR-149-5p	CLASH	23622248
MIRT044658	hsa-miR-320a	CLASH	23622248
MIRT043451	hsa-miR-331-3p	CLASH	23622248
MIRT043451	hsa-miR-331-3p	CLASH	23622248
MIRT042878	hsa-miR-324-3p	CLASH	23622248
MIRT041819	hsa-miR-484	CLASH	23622248
MIRT041819	hsa-miR-484	CLASH	23622248
MIRT041139	hsa-miR-501-5p	CLASH	23622248
MIRT039782	hsa-miR-615-3p	CLASH	23622248
MIRT039782	hsa-miR-615-3p	CLASH	23622248
MIRT039782	hsa-miR-615-3p	CLASH	23622248
MIRT039782	hsa-miR-615-3p	CLASH	23622248
MIRT039090	hsa-miR-769-3p	CLASH	23622248
MIRT039028	hsa-miR-766-3p	CLASH	23622248
MIRT038710	hsa-miR-29b-2-5p	CLASH	23622248
MIRT038579	hsa-miR-106b-3p	CLASH	23622248
MIRT038345	hsa-miR-296-3p	CLASH	23622248
MIRT038226	hsa-miR-342-5p	CLASH	23622248
MIRT038105	hsa-miR-423-5p	CLASH	23622248
MIRT038105	hsa-miR-423-5p	CLASH	23622248
MIRT036904	hsa-miR-877-3p	CLASH	23622248
MIRT036280	hsa-miR-1229-3p	CLASH	23622248
MIRT440587	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440587	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1012003	hsa-miR-1182	CLIP-seq
MIRT1012004	hsa-miR-1207-5p	CLIP-seq
MIRT1012005	hsa-miR-1236	CLIP-seq
MIRT1012006	hsa-miR-1275	CLIP-seq
MIRT1012007	hsa-miR-1294	CLIP-seq
MIRT1012008	hsa-miR-138	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012011	hsa-miR-218	CLIP-seq
MIRT1012012	hsa-miR-2355-5p	CLIP-seq
MIRT1012013	hsa-miR-3150b-3p	CLIP-seq
MIRT1012014	hsa-miR-3175	CLIP-seq
MIRT1012015	hsa-miR-3199	CLIP-seq
MIRT1012016	hsa-miR-323-5p	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012018	hsa-miR-3659	CLIP-seq
MIRT1012019	hsa-miR-3663-3p	CLIP-seq
MIRT1012020	hsa-miR-3688-5p	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012022	hsa-miR-4276	CLIP-seq
MIRT1012023	hsa-miR-4283	CLIP-seq
MIRT1012024	hsa-miR-4302	CLIP-seq
MIRT1012025	hsa-miR-4316	CLIP-seq
MIRT1012026	hsa-miR-4447	CLIP-seq
MIRT1012027	hsa-miR-4456	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012029	hsa-miR-4472	CLIP-seq
MIRT1012030	hsa-miR-4489	CLIP-seq
MIRT1012031	hsa-miR-4492	CLIP-seq
MIRT1012032	hsa-miR-4498	CLIP-seq
MIRT1012033	hsa-miR-4519	CLIP-seq
MIRT1012034	hsa-miR-4525	CLIP-seq
MIRT1012035	hsa-miR-4530	CLIP-seq
MIRT1012036	hsa-miR-4652-5p	CLIP-seq
MIRT1012037	hsa-miR-4658	CLIP-seq
MIRT1012038	hsa-miR-4665-5p	CLIP-seq
MIRT1012039	hsa-miR-4677-3p	CLIP-seq
MIRT1012040	hsa-miR-4685-5p	CLIP-seq
MIRT1012041	hsa-miR-4689	CLIP-seq
MIRT1012042	hsa-miR-4723-5p	CLIP-seq
MIRT1012043	hsa-miR-4731-5p	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012045	hsa-miR-4736	CLIP-seq
MIRT1012046	hsa-miR-4740-5p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012050	hsa-miR-4763-3p	CLIP-seq
MIRT1012051	hsa-miR-4779	CLIP-seq
MIRT1012052	hsa-miR-4784	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012054	hsa-miR-541	CLIP-seq
MIRT1012055	hsa-miR-574-5p	CLIP-seq
MIRT1012056	hsa-miR-581	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012058	hsa-miR-625	CLIP-seq
MIRT1012059	hsa-miR-644	CLIP-seq
MIRT1012060	hsa-miR-654-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012062	hsa-miR-762	CLIP-seq
MIRT1012063	hsa-miR-876-3p	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012003	hsa-miR-1182	CLIP-seq
MIRT1012004	hsa-miR-1207-5p	CLIP-seq
MIRT1012005	hsa-miR-1236	CLIP-seq
MIRT1012006	hsa-miR-1275	CLIP-seq
MIRT1012007	hsa-miR-1294	CLIP-seq
MIRT1012008	hsa-miR-138	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012011	hsa-miR-218	CLIP-seq
MIRT1012012	hsa-miR-2355-5p	CLIP-seq
MIRT1012013	hsa-miR-3150b-3p	CLIP-seq
MIRT1012014	hsa-miR-3175	CLIP-seq
MIRT1012015	hsa-miR-3199	CLIP-seq
MIRT1012016	hsa-miR-323-5p	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012018	hsa-miR-3659	CLIP-seq
MIRT1012019	hsa-miR-3663-3p	CLIP-seq
MIRT1012020	hsa-miR-3688-5p	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012022	hsa-miR-4276	CLIP-seq
MIRT1012023	hsa-miR-4283	CLIP-seq
MIRT1012024	hsa-miR-4302	CLIP-seq
MIRT1012025	hsa-miR-4316	CLIP-seq
MIRT1012026	hsa-miR-4447	CLIP-seq
MIRT1012027	hsa-miR-4456	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012029	hsa-miR-4472	CLIP-seq
MIRT1012030	hsa-miR-4489	CLIP-seq
MIRT1012031	hsa-miR-4492	CLIP-seq
MIRT1012032	hsa-miR-4498	CLIP-seq
MIRT1012033	hsa-miR-4519	CLIP-seq
MIRT1012034	hsa-miR-4525	CLIP-seq
MIRT1012035	hsa-miR-4530	CLIP-seq
MIRT1012036	hsa-miR-4652-5p	CLIP-seq
MIRT1012037	hsa-miR-4658	CLIP-seq
MIRT1012038	hsa-miR-4665-5p	CLIP-seq
MIRT1012039	hsa-miR-4677-3p	CLIP-seq
MIRT1012040	hsa-miR-4685-5p	CLIP-seq
MIRT1012041	hsa-miR-4689	CLIP-seq
MIRT1012042	hsa-miR-4723-5p	CLIP-seq
MIRT1012043	hsa-miR-4731-5p	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012045	hsa-miR-4736	CLIP-seq
MIRT1012046	hsa-miR-4740-5p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012050	hsa-miR-4763-3p	CLIP-seq
MIRT1012051	hsa-miR-4779	CLIP-seq
MIRT1012052	hsa-miR-4784	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012054	hsa-miR-541	CLIP-seq
MIRT1012055	hsa-miR-574-5p	CLIP-seq
MIRT1012056	hsa-miR-581	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012058	hsa-miR-625	CLIP-seq
MIRT1012059	hsa-miR-644	CLIP-seq
MIRT1012060	hsa-miR-654-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012062	hsa-miR-762	CLIP-seq
MIRT1012063	hsa-miR-876-3p	CLIP-seq
MIRT1012003	hsa-miR-1182	CLIP-seq
MIRT1012004	hsa-miR-1207-5p	CLIP-seq
MIRT1012005	hsa-miR-1236	CLIP-seq
MIRT1012006	hsa-miR-1275	CLIP-seq
MIRT1012007	hsa-miR-1294	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012011	hsa-miR-218	CLIP-seq
MIRT1012012	hsa-miR-2355-5p	CLIP-seq
MIRT1012013	hsa-miR-3150b-3p	CLIP-seq
MIRT1012014	hsa-miR-3175	CLIP-seq
MIRT1012015	hsa-miR-3199	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012018	hsa-miR-3659	CLIP-seq
MIRT1012019	hsa-miR-3663-3p	CLIP-seq
MIRT1012020	hsa-miR-3688-5p	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012022	hsa-miR-4276	CLIP-seq
MIRT1012024	hsa-miR-4302	CLIP-seq
MIRT1012025	hsa-miR-4316	CLIP-seq
MIRT1012026	hsa-miR-4447	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012029	hsa-miR-4472	CLIP-seq
MIRT1012033	hsa-miR-4519	CLIP-seq
MIRT1012034	hsa-miR-4525	CLIP-seq
MIRT1012036	hsa-miR-4652-5p	CLIP-seq
MIRT1012037	hsa-miR-4658	CLIP-seq
MIRT1012038	hsa-miR-4665-5p	CLIP-seq
MIRT1012039	hsa-miR-4677-3p	CLIP-seq
MIRT1012041	hsa-miR-4689	CLIP-seq
MIRT1012042	hsa-miR-4723-5p	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012045	hsa-miR-4736	CLIP-seq
MIRT1012046	hsa-miR-4740-5p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012050	hsa-miR-4763-3p	CLIP-seq
MIRT1012051	hsa-miR-4779	CLIP-seq
MIRT1012052	hsa-miR-4784	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012054	hsa-miR-541	CLIP-seq
MIRT1012055	hsa-miR-574-5p	CLIP-seq
MIRT1012056	hsa-miR-581	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012058	hsa-miR-625	CLIP-seq
MIRT1012059	hsa-miR-644	CLIP-seq
MIRT1012060	hsa-miR-654-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012005	hsa-miR-1236	CLIP-seq
MIRT1012004	hsa-miR-1207-5p	CLIP-seq
MIRT1012006	hsa-miR-1275	CLIP-seq
MIRT1012007	hsa-miR-1294	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012012	hsa-miR-2355-5p	CLIP-seq
MIRT1012013	hsa-miR-3150b-3p	CLIP-seq
MIRT1012014	hsa-miR-3175	CLIP-seq
MIRT1012015	hsa-miR-3199	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012018	hsa-miR-3659	CLIP-seq
MIRT1012020	hsa-miR-3688-5p	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012022	hsa-miR-4276	CLIP-seq
MIRT1012024	hsa-miR-4302	CLIP-seq
MIRT1012025	hsa-miR-4316	CLIP-seq
MIRT1012026	hsa-miR-4447	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012029	hsa-miR-4472	CLIP-seq
MIRT1012034	hsa-miR-4525	CLIP-seq
MIRT1012036	hsa-miR-4652-5p	CLIP-seq
MIRT1012037	hsa-miR-4658	CLIP-seq
MIRT1012038	hsa-miR-4665-5p	CLIP-seq
MIRT1012039	hsa-miR-4677-3p	CLIP-seq
MIRT1012041	hsa-miR-4689	CLIP-seq
MIRT1012042	hsa-miR-4723-5p	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012045	hsa-miR-4736	CLIP-seq
MIRT1012046	hsa-miR-4740-5p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012050	hsa-miR-4763-3p	CLIP-seq
MIRT1012051	hsa-miR-4779	CLIP-seq
MIRT1012052	hsa-miR-4784	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012054	hsa-miR-541	CLIP-seq
MIRT1012055	hsa-miR-574-5p	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012058	hsa-miR-625	CLIP-seq
MIRT1012059	hsa-miR-644	CLIP-seq
MIRT1012060	hsa-miR-654-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq
MIRT1012004	hsa-miR-1207-5p	CLIP-seq
MIRT1012006	hsa-miR-1275	CLIP-seq
MIRT1012007	hsa-miR-1294	CLIP-seq
MIRT1012009	hsa-miR-18a	CLIP-seq
MIRT1012010	hsa-miR-18b	CLIP-seq
MIRT1012012	hsa-miR-2355-5p	CLIP-seq
MIRT1012013	hsa-miR-3150b-3p	CLIP-seq
MIRT1012014	hsa-miR-3175	CLIP-seq
MIRT1012015	hsa-miR-3199	CLIP-seq
MIRT1012017	hsa-miR-3618	CLIP-seq
MIRT1012018	hsa-miR-3659	CLIP-seq
MIRT1012020	hsa-miR-3688-5p	CLIP-seq
MIRT1012021	hsa-miR-3936	CLIP-seq
MIRT1012022	hsa-miR-4276	CLIP-seq
MIRT1012024	hsa-miR-4302	CLIP-seq
MIRT1012025	hsa-miR-4316	CLIP-seq
MIRT1012026	hsa-miR-4447	CLIP-seq
MIRT1012028	hsa-miR-4466	CLIP-seq
MIRT1012029	hsa-miR-4472	CLIP-seq
MIRT1012034	hsa-miR-4525	CLIP-seq
MIRT1012036	hsa-miR-4652-5p	CLIP-seq
MIRT1012037	hsa-miR-4658	CLIP-seq
MIRT1012038	hsa-miR-4665-5p	CLIP-seq
MIRT1012039	hsa-miR-4677-3p	CLIP-seq
MIRT1012041	hsa-miR-4689	CLIP-seq
MIRT1012042	hsa-miR-4723-5p	CLIP-seq
MIRT1012044	hsa-miR-4735-3p	CLIP-seq
MIRT1012045	hsa-miR-4736	CLIP-seq
MIRT1012046	hsa-miR-4740-5p	CLIP-seq
MIRT1012047	hsa-miR-4747-3p	CLIP-seq
MIRT1012048	hsa-miR-4749-3p	CLIP-seq
MIRT1012049	hsa-miR-4761-5p	CLIP-seq
MIRT1012050	hsa-miR-4763-3p	CLIP-seq
MIRT1012051	hsa-miR-4779	CLIP-seq
MIRT1012052	hsa-miR-4784	CLIP-seq
MIRT1012053	hsa-miR-4802-3p	CLIP-seq
MIRT1012054	hsa-miR-541	CLIP-seq
MIRT1012055	hsa-miR-574-5p	CLIP-seq
MIRT1012057	hsa-miR-624	CLIP-seq
MIRT1012058	hsa-miR-625	CLIP-seq
MIRT1012059	hsa-miR-644	CLIP-seq
MIRT1012060	hsa-miR-654-5p	CLIP-seq
MIRT1012061	hsa-miR-675	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CEBPA	Unknown	12842822
CEBPD	Unknown	12842822
HIF1A	Unknown	11955624

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	ISS
GO:0001819	Process	Positive regulation of cytokine production	IDA	22832495
GO:0002376	Process	Immune system process	IEA
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	IBA
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	IEA
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	ISS
GO:0004365	Function	Glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity	NAS	3170585, 7030790
GO:0005515	Function	Protein binding	IPI	11724794, 15628863, 16169070, 16799092, 17500595, 17540579, 20029029, 20392205, 20849852, 21044950, 23332158, 23348613, 23355646, 24658140, 25417112, 27387501, 28514442, 29028794, 29128334, 31980649, 32814053, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	28404743
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IDA	11785981, 24507776
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005811	Component	Lipid droplet	IDA	14741744
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	24101517, 28404743
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0010951	Process	Negative regulation of endopeptidase activity	IDA	22832495
GO:0015630	Component	Microtubule cytoskeleton	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016241	Process	Regulation of macroautophagy	TAS	26626483
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	23071094
GO:0017148	Process	Negative regulation of translation	IMP	15479637
GO:0019828	Function	Aspartic-type endopeptidase inhibitor activity	IDA	22832495
GO:0031640	Process	Killing of cells of another organism	IDA	22832495
GO:0031965	Component	Nuclear membrane	IDA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032481	Process	Positive regulation of type I interferon production	IDA	27387501
GO:0035605	Function	Peptidyl-cysteine S-nitrosylase activity	IEA
GO:0035605	Function	Peptidyl-cysteine S-nitrosylase activity	ISS
GO:0035606	Process	Peptidyl-cysteine S-trans-nitrosylation	ISS
GO:0042802	Function	Identical protein binding	IPI	20392205, 21988832
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	23332158
GO:0045087	Process	Innate immune response	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050661	Function	NADP binding	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0050832	Process	Defense response to fungus	IDA	22832495
GO:0051287	Function	NAD binding	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051873	Process	Killing by host of symbiont cells	IDA	22832495
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	22832495
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19056867, 19199708, 20458337, 21362503, 23533145
GO:0071346	Process	Cellular response to type II interferon	IDA	15479637
GO:0097452	Component	GAIT complex	IDA	15479637, 23071094
GO:0097718	Function	Disordered domain specific binding	IPI	11785981
GO:1990904	Component	Ribonucleoprotein complex	IDA	15479637

MIM	HGNC	e!Ensembl
138400	4141	ENSG00000111640

P04406

Protein name

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (EC 1.2.1.12) (Peptidyl-cysteine S-nitrosylase GAPDH) (EC 2.6.99.-)

Protein function

Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively (PubMed:11724794, PubMed:3170585). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in

PDB

1U8F , 1ZNQ , 3GPD , 4WNC , 4WNI , 6ADE , 6IQ6 , 6M61 , 6YND , 6YNE , 6YNF , 6YNH , 8DNS , 8G12 , 8G13 , 8G14 , 8G15 , 8G16 , 8G17 , 8P5F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00044	Gp_dh_N	4 → 105	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Domain
PF02800	Gp_dh_C	157 → 314	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain	Domain

Sequence

MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Metabolic pathways Carbon metabolism Biosynthesis of amino acids HIF-1 signaling pathway Alzheimer disease Pathogenic Escherichia coli infection Salmonella infection Diabetic cardiomyopathy		Glycolysis Gluconeogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY 21, PRIMARY, AUTOSOMAL RECESSIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (289)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acidosis Lactic	Lactic acidosis	Pubtator	19571378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	12466375		★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	10768834, 10902805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15293568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	16340238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17922974, 20494472, 3180054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14963017, 31421831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	3180054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11489141, 12039695, 12466375, 24135907, 27561203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	12466375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11208907, 15507493, 18340469, 20838239, 22258516, 32469899, 34326892, 37418137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15507493, 16832079, 20864222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	25022884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15020220, 16461917, 29104532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	1395049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	31447347		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27494892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	11815431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	11815431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	9264495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	23465095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	23455884, 27080476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	32321348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11415932, 12200519, 18417509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12200519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17597534, 20849807, 31322210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28589519, 30259794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33706714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	27754318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28503176, 29072876		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	12040449		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29658582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26688097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	29474985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Beta thalassemia intermedia	beta Thalassemia	BEFREE	29474985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	27727313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	27727313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11172490, 16734859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	1924305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	19526291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	9458162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	9458162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10885609, 12498774, 16326072, 17108228, 21338575, 22847419, 25620657, 28332571, 28476800, 30311703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17391528, 21738817, 22552268, 22847419, 25617865, 32649310, 34752497, 40604083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18629778, 36683335	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22874552	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	27816501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	19604504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18974881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11076659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12036445, 12898236, 20034753, 23445303, 9826470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37741973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	15077124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12404288, 17627933, 17640361, 19036168, 23771368, 29180379, 32084009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	35880695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11172490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	28225552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	14511611, 14624785, 15474665, 17922974, 20682026, 21503779, 23377192, 31567534, 3664468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24885929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	15077124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17442564, 18708368, 19331211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15808768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	28962519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	11812662, 15698596, 9788826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35318719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9826470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9826470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	32915926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	38282590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16467170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34975312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19736238, 8666326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27878251, 28184026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11212261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17047489, 17880935, 29067439, 31409279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	25944804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22350014, 22895844, 24383454, 29067439, 31409279, 32424999, 33092235, 36706634, 37124724, 38376276	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	25944804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	17384445, 28390990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10897012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20644648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	20644648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20644648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24859296, 9072008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	25550585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15094325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	12722924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33289509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19997558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15115683, 19997558, 25970163, 26255202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36187097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37174719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12527413, 36627346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14636302, 17611901, 20408053, 28608282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	20408053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26438826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	14655758, 30827861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666670, 7891898, 9578511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	8893764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	31656725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27816501, 29489588, 31759082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	21081112		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	24464349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17442564, 19331211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	30474100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	12904697, 24423317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	8893764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	12364475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fukuyama Type Congenital Muscular Dystrophy	Fukuyama Type Congenital Muscular Dystrophy	BEFREE	18830929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	12576454, 2121331		★★★★★ ★☆☆☆☆ Found in Text Mining only
gaze palsy familial horizontal with progressive scoliosis	Horizontal gaze palsy with progressive scoliosis	Pubtator	23289769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15138583, 17597534, 20022592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17597534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30259794, 35327982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37420311	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15138583, 17597534, 20022592, 30700763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11876468, 15138583, 17196947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34573317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 45,X	Gonadal Dysgenesis	BEFREE	17259241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35401560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28635628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28390990		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	11854637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	19892936		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	19892936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22552268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18932288	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	27255110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	29474985		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	14555664		★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	8220138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1774960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11208907	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	12008025, 12428732, 21775503, 26268247, 30254002, 9779656, 9894873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	12008025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	29068569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	16467170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22273152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	9264495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30332478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10364451, 17597534, 29180379, 33640700, 34853621	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	35408935, 36826702	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	15954921		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18202089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	24464349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24859296, 30917710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32424999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12031655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37302023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10520027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	11031081, 26258539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12142376, 12898236, 16149130, 18202799, 19036168, 21953322, 22964488, 23771368, 26045814, 2839830, 29180379, 30786811, 31239764, 8666326, 9378702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16767786, 21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19736238, 8666326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27255110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	22350014	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2839830, 9378702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	14511611, 14624785, 3089988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19657000, 19800890, 21749859, 27802291, 29467444, 34970420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19811272	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31049359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10378513, 19604504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	14655758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	32442224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	19604504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10885609, 12498774, 1378704, 16326072, 17108228, 21338575, 22847419, 25620657, 28332571, 28476800, 30311703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16278388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	28225552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19036168, 30232003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14511611, 14624785, 15474665, 17922974, 20682026, 21503779, 3089988, 31567534, 3664468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18708368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15115683, 31324208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16326072, 18586020, 18651557, 18974881, 23433128, 9826470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19302034, 19903463, 25785838, 25986864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17540725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11172490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14511611, 14624785, 16515701, 17390034, 18651557, 18708368, 19161537, 20682026, 22847419, 23046102, 23377192, 23445303, 25308277, 25785838, 25944651 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	9826470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27878251, 28184026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12498774, 15287981, 18629778		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12538475, 12544092, 18554498, 23026046, 25550585, 31567589, 9182821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18554498, 31567589, 37895015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29079997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30537064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28167533, 34970420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	27816501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	10097256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14692531, 23990051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17015754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26395032, 30150703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32655763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	19318579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11031081	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10378372, 10471520, 10885609, 10897012, 11011077, 11231991, 11251164, 11476540, 11526511, 11678335, 11782386, 11848476, 12168836, 12498774, 12898236 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	31496514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28432433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10769746, 12576454, 20022592, 2121331, 21775503, 25805836, 29016861, 29777694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11208907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10407139, 12428732, 25022884, 27215901, 29886133, 30254002, 30658140, 31027346, 9587422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	31049359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	21739307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11804687, 16319328, 23988223, 25573171, 31232177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19997558, 31231489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22836687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	19269131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38247858	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	27389089		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	27389089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17609619		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18708368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16036111, 18708368, 21979951, 28031236, 32705257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15115683, 31324208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30296496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15115683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21739307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paralysis	Paralysis	Pubtator	26843329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	10843188, 15009006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11031081, 12428732, 26258539, 27859598, 28830811, 29408361, 29886133, 30254002, 30983487, 31759082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	11031081, 26258539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	27859598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	730182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20178540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	20380724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	17236194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15293568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15094325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11489141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16326072, 18586020, 18651557, 18974881, 23433128, 7671226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17553795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29386530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	10721821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24852194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	14555664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10897012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	12668266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32118793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	20408053, 28503176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	36148636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	36362243	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17712000, 30208760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	39201484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	14569272, 18639743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	23289769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	22991145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	15823405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24858725, 28753256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15735160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	31122244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27893852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	9779656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12926130, 18621570, 25944651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12679316, 26635288, 27889881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19650912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29489588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21913943, 9917513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19302034, 25785838, 25986864, 30695048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507635, 25081706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	11172490, 15636669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17167184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	12616366, 12643848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	LHGDN	15001839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20039900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17540725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	17540725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17540725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11076659, 33035689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28075450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30773992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	17259241, 20422505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	11076659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	12904697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	8207043		★★★★★ ★☆☆☆☆ Found in Text Mining only

GAPDH (glyceraldehyde-3-phosphate dehydrogenase)