GAP43 (growth associated protein 43)

Gene

• Entrez ID: 2596
• Gene name: Growth associated protein 43
• Gene symbol: GAP43
• Synonyms (NCBI Gene): B-50, GAP-43, PP46
• Chromosome: 3
• Chromosome location: 3q13.31
• Summary: The protein encoded by this gene has been termed a `growth` or `plasticity` protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT735583	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32095982
MIRT489932	hsa-miR-890	PAR-CLIP	23592263
MIRT489931	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT489930	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT489929	hsa-miR-3125	PAR-CLIP	23592263
MIRT489928	hsa-miR-3916	PAR-CLIP	23592263
MIRT489927	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT489926	hsa-miR-3614-5p	PAR-CLIP	23592263
MIRT1011993	hsa-miR-1293	CLIP-seq
MIRT1011994	hsa-miR-3153	CLIP-seq
MIRT1011995	hsa-miR-4483	CLIP-seq
MIRT1011996	hsa-miR-4668-5p	CLIP-seq
MIRT1011997	hsa-miR-4727-3p	CLIP-seq
MIRT1011998	hsa-miR-3202	CLIP-seq
MIRT1011999	hsa-miR-4475	CLIP-seq
MIRT1012000	hsa-miR-4476	CLIP-seq
MIRT1012001	hsa-miR-4796-3p	CLIP-seq
MIRT1012002	hsa-miR-759	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT2537045	hsa-miR-1261	CLIP-seq
MIRT2537046	hsa-miR-130a	CLIP-seq
MIRT2537047	hsa-miR-130b	CLIP-seq
MIRT2537048	hsa-miR-148a	CLIP-seq
MIRT2537049	hsa-miR-148b	CLIP-seq
MIRT2537050	hsa-miR-152	CLIP-seq
MIRT2537051	hsa-miR-188-3p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT2537052	hsa-miR-301a	CLIP-seq
MIRT2537053	hsa-miR-301b	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT2537054	hsa-miR-3666	CLIP-seq
MIRT2537055	hsa-miR-3671	CLIP-seq
MIRT2537056	hsa-miR-3918	CLIP-seq
MIRT2537057	hsa-miR-4295	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT2537058	hsa-miR-454	CLIP-seq
MIRT2537059	hsa-miR-4696	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq
MIRT1999811	hsa-miR-24	CLIP-seq
MIRT1999812	hsa-miR-3664-3p	CLIP-seq
MIRT1999813	hsa-miR-4433	CLIP-seq
MIRT1999814	hsa-miR-4450	CLIP-seq
MIRT1999815	hsa-miR-4459	CLIP-seq
MIRT1999816	hsa-miR-4728-5p	CLIP-seq
MIRT1999817	hsa-miR-4768-3p	CLIP-seq
MIRT1999818	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IEA
GO:0005515	Function	Protein binding	IPI	9139733, 30664241, 32814053
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	3272162
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0009611	Process	Response to wounding	TAS	3272162
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016198	Process	Axon choice point recognition	IBA
GO:0016198	Process	Axon choice point recognition	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031103	Process	Axon regeneration	IBA
GO:0031527	Component	Filopodium membrane	IDA	14978216
GO:0031527	Component	Filopodium membrane	IEA
GO:0032584	Component	Growth cone membrane	IEA
GO:0035727	Function	Lysophosphatidic acid binding	IBA
GO:0035727	Function	Lysophosphatidic acid binding	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0042246	Process	Tissue regeneration	IBA
GO:0042246	Process	Tissue regeneration	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045202	Component	Synapse	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0051489	Process	Regulation of filopodium assembly	IDA	14978216
GO:0060019	Process	Radial glial cell differentiation	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099150	Process	Regulation of postsynaptic specialization assembly	IEA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IBA
GO:1901981	Function	Phosphatidylinositol phosphate binding	IEA

Other IDs

• MIM: 162060
• HGNC: 4140
• e!Ensembl: ENSG00000172020

Protein

• UniProt ID: P17677
• Protein name: Neuromodulin (Axonal membrane protein GAP-43) (Growth-associated protein 43) (Neural phosphoprotein B-50) (pp46)
• Protein function: This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction. {ECO:0000269|PubMed:14978216, ECO:0000269|PubMed
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10580	Neuromodulin_N	2 → 31	Gap junction protein N-terminal region	Domain
  PF00612	IQ	32 → 52	IQ calmodulin-binding motif	Motif
  PF06614	Neuromodulin	67 → 238	Neuromodulin	Family

• Sequence:

  MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQ
  AAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAAT
  EQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAAT
  TPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

• Sequence length: 238

Pathways

Reactome:

L1CAM interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTHYMIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	2153893		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27604409	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30342961, 3368468, 36611808, 36635346, 7566340, 7573369, 9011750	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32776690	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	1387517, 9631437		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	Pubtator	36739296	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30690892, 30776178		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	7573369		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	24301786		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	24301786	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11208668		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	12495447, 35296631	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19479712		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29707580		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	33686834	Stimulate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29486290		★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	9396008		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27956400, 30526557, 31264264		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32776690	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33402155	Inhibit	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	10366005		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28075461, 29393906		★☆☆☆☆ Found in Text Mining only
Cortical Dysplasia	Cortical Dysplasia	BEFREE	10884025, 29255203		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11215757, 7573369		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	29324989	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	7573369	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	11351137		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31705954, 31843630, 9774774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	9774774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	22705139, 29885017		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22705139, 28658037, 29684105, 29885017		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22209024		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	22209024		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	23685187	Inhibit	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666665		★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic Disorder	BEFREE	11072752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysthymic Disorder	Dysthymic Disorder	PSYGENET_DG	11072752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	22209024		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17412328	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29255203		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	11072752, 11351137		★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	8246962		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24601786	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12395413		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34173871, 36739296	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	6372895	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	10366005		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	24301786		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	GENOMICS_ENGLAND_DG	22325380		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29654647		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29654647	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GENOMICS_ENGLAND_DG	22325380		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	GENOMICS_ENGLAND_DG	22325380		★☆☆☆☆ Found in Text Mining only
Infantile neuronal ceroid lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	16644870		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28574417		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30526557		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31568662	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31568662		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23887302	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31705954, 31843630, 9774774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	9774774		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild cognitive disorder	Cognitive disorder	BEFREE	30372675		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	18615010		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor Neuron Disease	Motor Neuron Disease	BEFREE	25175067		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	7573369	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	25175067		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25175067, 31754174		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25231264	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31754174	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29860489, 30121216		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36759072	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21981408, 27495233, 28419303, 31568662		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	25175067		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	26121316		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1374507, 19216736, 20694854, 23417100, 31183633, 8246962, 8477653, 9006328		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17409494, 19216736, 19460840, 29507419, 33230715, 33402155, 8344386, 9006328	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21194500	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40229714, 7573369	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30321501		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	23887302	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	29656327		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22705139, 26071889		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	10366005		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30419922		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31568662		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11072752, 26748453, 31381529		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26748453	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	26071889		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	10366005		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	2153893		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	11072752, 11351137		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11215757, 7573369		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	20560891		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11208668, 18622782, 21145444, 22138049, 9881859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	11208668, 17012697, 21145444, 22138049		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34667143, 8943081	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	11215757, 9011750		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28465478		★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	22209024		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	10366005		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	28535499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	10366005		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30392635		★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	36066284	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31568662	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31568662		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31568662		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31568662	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35958598	Associate	★☆☆☆☆ Found in Text Mining only