Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	25959
Gene name	KN motif and ankyrin repeat domains 2
Gene symbol	KANK2
Synonyms (NCBI Gene)	ANKRD25MXRA3NPHS16PPKWHSIP
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a member of the KN motif and ankyrin repeat domains (KANK) family of proteins, which play a role in cytoskeletal formation by regulating actin polymerization. The encoded protein functions in the sequestration of steroid receptor coactiv

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs606231303	G>A	Pathogenic	Coding sequence variant, missense variant
rs1555816634	G>A	Pathogenic	Coding sequence variant, missense variant
rs1555820663	T>C	Pathogenic	Coding sequence variant, missense variant

321

Show/Hide all (321)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016547	hsa-miR-193b-3p	Microarray	20304954
MIRT020755	hsa-miR-155-5p	Proteomics	18668040
MIRT022589	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT023699	hsa-miR-1-3p	Proteomics	18668040
MIRT029311	hsa-miR-26b-5p	Microarray	19088304
MIRT049313	hsa-miR-92a-3p	CLASH	23622248
MIRT044246	hsa-miR-106b-5p	CLASH	23622248
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT661216	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT661215	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT661214	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT661216	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT661215	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT661214	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT661216	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT661215	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT661214	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT661216	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT661215	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT661214	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617119	hsa-miR-7151-5p	HITS-CLIP	23824327
MIRT617118	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT617117	hsa-miR-4793-5p	HITS-CLIP	23824327
MIRT617116	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT617115	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT617114	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT617113	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT1078513	hsa-miR-130a	CLIP-seq
MIRT1078514	hsa-miR-130b	CLIP-seq
MIRT1078515	hsa-miR-1343	CLIP-seq
MIRT1078516	hsa-miR-141	CLIP-seq
MIRT1078517	hsa-miR-200a	CLIP-seq
MIRT1078518	hsa-miR-2276	CLIP-seq
MIRT1078519	hsa-miR-301a	CLIP-seq
MIRT1078520	hsa-miR-301b	CLIP-seq
MIRT1078521	hsa-miR-3159	CLIP-seq
MIRT1078522	hsa-miR-3616-5p	CLIP-seq
MIRT1078523	hsa-miR-3647-5p	CLIP-seq
MIRT1078524	hsa-miR-3662	CLIP-seq
MIRT1078525	hsa-miR-3666	CLIP-seq
MIRT1078526	hsa-miR-370	CLIP-seq
MIRT1078527	hsa-miR-3929	CLIP-seq
MIRT1078528	hsa-miR-3977	CLIP-seq
MIRT1078529	hsa-miR-4263	CLIP-seq
MIRT1078530	hsa-miR-4295	CLIP-seq
MIRT1078531	hsa-miR-4419b	CLIP-seq
MIRT1078532	hsa-miR-4466	CLIP-seq
MIRT1078533	hsa-miR-4478	CLIP-seq
MIRT1078534	hsa-miR-454	CLIP-seq
MIRT1078535	hsa-miR-4640-5p	CLIP-seq
MIRT1078536	hsa-miR-4666-5p	CLIP-seq
MIRT1078537	hsa-miR-4726-5p	CLIP-seq
MIRT1078538	hsa-miR-4768-5p	CLIP-seq
MIRT1078539	hsa-miR-4772-3p	CLIP-seq
MIRT1078540	hsa-miR-4795-5p	CLIP-seq
MIRT1078541	hsa-miR-519a	CLIP-seq
MIRT1078542	hsa-miR-519b-3p	CLIP-seq
MIRT1078543	hsa-miR-519c-3p	CLIP-seq
MIRT1078544	hsa-miR-548q	CLIP-seq
MIRT1078545	hsa-miR-573	CLIP-seq
MIRT1078546	hsa-miR-582-3p	CLIP-seq
MIRT1078547	hsa-miR-651	CLIP-seq
MIRT1078548	hsa-miR-659	CLIP-seq
MIRT1078549	hsa-miR-664	CLIP-seq
MIRT1078550	hsa-miR-675	CLIP-seq
MIRT1078551	hsa-miR-9	CLIP-seq
MIRT1078552	hsa-miR-126	CLIP-seq
MIRT1078553	hsa-miR-1281	CLIP-seq
MIRT1078554	hsa-miR-193a-3p	CLIP-seq
MIRT1078555	hsa-miR-193b	CLIP-seq
MIRT1078556	hsa-miR-200b	CLIP-seq
MIRT1078557	hsa-miR-200c	CLIP-seq
MIRT1078558	hsa-miR-2054	CLIP-seq
MIRT1078559	hsa-miR-3119	CLIP-seq
MIRT1078560	hsa-miR-3652	CLIP-seq
MIRT1078561	hsa-miR-4281	CLIP-seq
MIRT1078562	hsa-miR-429	CLIP-seq
MIRT1078563	hsa-miR-4430	CLIP-seq
MIRT1078564	hsa-miR-4469	CLIP-seq
MIRT1078565	hsa-miR-4505	CLIP-seq
MIRT1078566	hsa-miR-595	CLIP-seq
MIRT1078567	hsa-miR-892b	CLIP-seq
MIRT2019539	hsa-miR-3199	CLIP-seq
MIRT2019540	hsa-miR-320a	CLIP-seq
MIRT2019541	hsa-miR-320b	CLIP-seq
MIRT2019542	hsa-miR-320c	CLIP-seq
MIRT2019543	hsa-miR-320d	CLIP-seq
MIRT2019544	hsa-miR-330-3p	CLIP-seq
MIRT1078526	hsa-miR-370	CLIP-seq
MIRT2019545	hsa-miR-371-5p	CLIP-seq
MIRT2019546	hsa-miR-371b-5p	CLIP-seq
MIRT2019547	hsa-miR-4429	CLIP-seq
MIRT2019548	hsa-miR-4438	CLIP-seq
MIRT1078538	hsa-miR-4768-5p	CLIP-seq
MIRT2019549	hsa-miR-5095	CLIP-seq
MIRT2019550	hsa-miR-513c	CLIP-seq
MIRT2019551	hsa-miR-514b-5p	CLIP-seq
MIRT2019552	hsa-miR-562	CLIP-seq
MIRT2251379	hsa-miR-103b	CLIP-seq
MIRT2251380	hsa-miR-1178	CLIP-seq
MIRT2251381	hsa-miR-1183	CLIP-seq
MIRT2251382	hsa-miR-1208	CLIP-seq
MIRT2251383	hsa-miR-1252	CLIP-seq
MIRT2251384	hsa-miR-1253	CLIP-seq
MIRT2251385	hsa-miR-125a-5p	CLIP-seq
MIRT2251386	hsa-miR-125b	CLIP-seq
MIRT1078552	hsa-miR-126	CLIP-seq
MIRT1078515	hsa-miR-1343	CLIP-seq
MIRT2251387	hsa-miR-150	CLIP-seq
MIRT2251388	hsa-miR-185	CLIP-seq
MIRT1078554	hsa-miR-193a-3p	CLIP-seq
MIRT1078555	hsa-miR-193b	CLIP-seq
MIRT1078556	hsa-miR-200b	CLIP-seq
MIRT1078557	hsa-miR-200c	CLIP-seq
MIRT1078558	hsa-miR-2054	CLIP-seq
MIRT2251389	hsa-miR-2116	CLIP-seq
MIRT2251390	hsa-miR-22	CLIP-seq
MIRT2251391	hsa-miR-24	CLIP-seq
MIRT2251392	hsa-miR-2467-3p	CLIP-seq
MIRT2251393	hsa-miR-298	CLIP-seq
MIRT2251394	hsa-miR-3074-3p	CLIP-seq
MIRT1078559	hsa-miR-3119	CLIP-seq
MIRT2251395	hsa-miR-3123	CLIP-seq
MIRT2251396	hsa-miR-3137	CLIP-seq
MIRT2251397	hsa-miR-3138	CLIP-seq
MIRT2019539	hsa-miR-3199	CLIP-seq
MIRT2251398	hsa-miR-3201	CLIP-seq
MIRT2019540	hsa-miR-320a	CLIP-seq
MIRT2019541	hsa-miR-320b	CLIP-seq
MIRT2019542	hsa-miR-320c	CLIP-seq
MIRT2019543	hsa-miR-320d	CLIP-seq
MIRT2019544	hsa-miR-330-3p	CLIP-seq
MIRT2251399	hsa-miR-338-3p	CLIP-seq
MIRT2251400	hsa-miR-339-5p	CLIP-seq
MIRT2251401	hsa-miR-34a	CLIP-seq
MIRT2251402	hsa-miR-34c-5p	CLIP-seq
MIRT2251403	hsa-miR-3609	CLIP-seq
MIRT2251404	hsa-miR-361-5p	CLIP-seq
MIRT1078522	hsa-miR-3616-5p	CLIP-seq
MIRT2251405	hsa-miR-3620	CLIP-seq
MIRT1078523	hsa-miR-3647-5p	CLIP-seq
MIRT2251406	hsa-miR-3650	CLIP-seq
MIRT2251407	hsa-miR-3679-3p	CLIP-seq
MIRT1078526	hsa-miR-370	CLIP-seq
MIRT2019545	hsa-miR-371-5p	CLIP-seq
MIRT2019546	hsa-miR-371b-5p	CLIP-seq
MIRT2251408	hsa-miR-383	CLIP-seq
MIRT1078527	hsa-miR-3929	CLIP-seq
MIRT2251409	hsa-miR-4280	CLIP-seq
MIRT1078562	hsa-miR-429	CLIP-seq
MIRT2251410	hsa-miR-4291	CLIP-seq
MIRT2251411	hsa-miR-4306	CLIP-seq
MIRT2251412	hsa-miR-4319	CLIP-seq
MIRT2251413	hsa-miR-4324	CLIP-seq
MIRT1078531	hsa-miR-4419b	CLIP-seq
MIRT2019547	hsa-miR-4429	CLIP-seq
MIRT2251414	hsa-miR-4437	CLIP-seq
MIRT2019548	hsa-miR-4438	CLIP-seq
MIRT1078533	hsa-miR-4478	CLIP-seq
MIRT2251415	hsa-miR-449a	CLIP-seq
MIRT2251416	hsa-miR-449b	CLIP-seq
MIRT1078535	hsa-miR-4640-5p	CLIP-seq
MIRT2251417	hsa-miR-4644	CLIP-seq
MIRT2251418	hsa-miR-4677-5p	CLIP-seq
MIRT2251419	hsa-miR-4680-5p	CLIP-seq
MIRT2251420	hsa-miR-4685-5p	CLIP-seq
MIRT2251421	hsa-miR-4708-5p	CLIP-seq
MIRT2251422	hsa-miR-4711-5p	CLIP-seq
MIRT2251423	hsa-miR-4716-5p	CLIP-seq
MIRT1078537	hsa-miR-4726-5p	CLIP-seq
MIRT2251424	hsa-miR-4729	CLIP-seq
MIRT2251425	hsa-miR-4732-5p	CLIP-seq
MIRT2251426	hsa-miR-4772-5p	CLIP-seq
MIRT2251427	hsa-miR-4781-5p	CLIP-seq
MIRT2251428	hsa-miR-4786-3p	CLIP-seq
MIRT2251429	hsa-miR-4791	CLIP-seq
MIRT1078540	hsa-miR-4795-5p	CLIP-seq
MIRT2251430	hsa-miR-4800-5p	CLIP-seq
MIRT2251431	hsa-miR-486-3p	CLIP-seq
MIRT2019549	hsa-miR-5095	CLIP-seq
MIRT2019550	hsa-miR-513c	CLIP-seq
MIRT2019551	hsa-miR-514b-5p	CLIP-seq
MIRT1078541	hsa-miR-519a	CLIP-seq
MIRT1078542	hsa-miR-519b-3p	CLIP-seq
MIRT1078543	hsa-miR-519c-3p	CLIP-seq
MIRT2251432	hsa-miR-545	CLIP-seq
MIRT2251433	hsa-miR-548aa	CLIP-seq
MIRT2251434	hsa-miR-548ah	CLIP-seq
MIRT2019552	hsa-miR-562	CLIP-seq
MIRT1078545	hsa-miR-573	CLIP-seq
MIRT2251435	hsa-miR-579	CLIP-seq
MIRT1078566	hsa-miR-595	CLIP-seq
MIRT2251436	hsa-miR-643	CLIP-seq
MIRT1078548	hsa-miR-659	CLIP-seq
MIRT2251437	hsa-miR-662	CLIP-seq
MIRT1078549	hsa-miR-664	CLIP-seq
MIRT2251438	hsa-miR-711	CLIP-seq
MIRT2251439	hsa-miR-720	CLIP-seq
MIRT2251440	hsa-miR-744	CLIP-seq
MIRT1078567	hsa-miR-892b	CLIP-seq
MIRT1078551	hsa-miR-9	CLIP-seq
MIRT2251381	hsa-miR-1183	CLIP-seq
MIRT2251382	hsa-miR-1208	CLIP-seq
MIRT2251396	hsa-miR-3137	CLIP-seq
MIRT2251420	hsa-miR-4685-5p	CLIP-seq
MIRT2438068	hsa-miR-1224-3p	CLIP-seq
MIRT2438069	hsa-miR-1260	CLIP-seq
MIRT2438070	hsa-miR-1260b	CLIP-seq
MIRT2438071	hsa-miR-1280	CLIP-seq
MIRT2438072	hsa-miR-188-3p	CLIP-seq
MIRT2438073	hsa-miR-1976	CLIP-seq
MIRT2438074	hsa-miR-3065-5p	CLIP-seq
MIRT2438075	hsa-miR-3126-3p	CLIP-seq
MIRT2438076	hsa-miR-3128	CLIP-seq
MIRT2438077	hsa-miR-3156-3p	CLIP-seq
MIRT2438078	hsa-miR-3671	CLIP-seq
MIRT2438079	hsa-miR-4640-3p	CLIP-seq
MIRT2438080	hsa-miR-4667-3p	CLIP-seq
MIRT2438081	hsa-miR-4720-5p	CLIP-seq
MIRT2438082	hsa-miR-4762-5p	CLIP-seq
MIRT1078539	hsa-miR-4772-3p	CLIP-seq
MIRT2438083	hsa-miR-4799-3p	CLIP-seq
MIRT2438084	hsa-miR-607	CLIP-seq
MIRT2452108	hsa-miR-1182	CLIP-seq
MIRT2452109	hsa-miR-1275	CLIP-seq
MIRT2452110	hsa-miR-299-3p	CLIP-seq
MIRT2452111	hsa-miR-3151	CLIP-seq
MIRT2452112	hsa-miR-3179	CLIP-seq
MIRT1078526	hsa-miR-370	CLIP-seq
MIRT1078527	hsa-miR-3929	CLIP-seq
MIRT1078531	hsa-miR-4419b	CLIP-seq
MIRT2452113	hsa-miR-4447	CLIP-seq
MIRT2452114	hsa-miR-4472	CLIP-seq
MIRT1078533	hsa-miR-4478	CLIP-seq
MIRT2452115	hsa-miR-4525	CLIP-seq
MIRT2452116	hsa-miR-4665-5p	CLIP-seq
MIRT2452117	hsa-miR-4723-5p	CLIP-seq
MIRT2452118	hsa-miR-491-5p	CLIP-seq
MIRT2452119	hsa-miR-625	CLIP-seq
MIRT2251439	hsa-miR-720	CLIP-seq
MIRT2452109	hsa-miR-1275	CLIP-seq
MIRT2452110	hsa-miR-299-3p	CLIP-seq
MIRT2452111	hsa-miR-3151	CLIP-seq
MIRT2452112	hsa-miR-3179	CLIP-seq
MIRT2019539	hsa-miR-3199	CLIP-seq
MIRT2019548	hsa-miR-4438	CLIP-seq
MIRT2452113	hsa-miR-4447	CLIP-seq
MIRT2452114	hsa-miR-4472	CLIP-seq
MIRT2452115	hsa-miR-4525	CLIP-seq
MIRT2452116	hsa-miR-4665-5p	CLIP-seq
MIRT2452117	hsa-miR-4723-5p	CLIP-seq
MIRT2554666	hsa-miR-4794	CLIP-seq
MIRT2452118	hsa-miR-491-5p	CLIP-seq
MIRT2019549	hsa-miR-5095	CLIP-seq
MIRT2452119	hsa-miR-625	CLIP-seq
MIRT2452109	hsa-miR-1275	CLIP-seq
MIRT2452110	hsa-miR-299-3p	CLIP-seq
MIRT2452111	hsa-miR-3151	CLIP-seq
MIRT2452112	hsa-miR-3179	CLIP-seq
MIRT2452113	hsa-miR-4447	CLIP-seq
MIRT2452114	hsa-miR-4472	CLIP-seq
MIRT2452115	hsa-miR-4525	CLIP-seq
MIRT2452116	hsa-miR-4665-5p	CLIP-seq
MIRT2452117	hsa-miR-4723-5p	CLIP-seq
MIRT2554666	hsa-miR-4794	CLIP-seq
MIRT2452118	hsa-miR-491-5p	CLIP-seq
MIRT2452119	hsa-miR-625	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17476305
GO:0005515	Function	Protein binding	IPI	17476305, 21516116, 22371500, 24722188, 25416956, 25961457, 29183992, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17476305, 25961457
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	22371500
GO:0005739	Component	Mitochondrion	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	17476305
GO:0030837	Process	Negative regulation of actin filament polymerization	IEA
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IBA
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IDA	17476305
GO:0035023	Process	Regulation of Rho protein signal transduction	IEA
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	25961457
GO:0043069	Process	Negative regulation of programmed cell death	IDA	22371500
GO:0070563	Process	Negative regulation of vitamin D receptor signaling pathway	IBA
GO:0070563	Process	Negative regulation of vitamin D receptor signaling pathway	IMP	24671081
GO:0072073	Process	Kidney epithelium development	IMP	25961457
GO:0090521	Process	Podocyte cell migration	IEA
GO:0090521	Process	Podocyte cell migration	IMP	25961457
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	17476305

MIM	HGNC	e!Ensembl
614610	29300	ENSG00000197256

Q63ZY3

Protein name

KN motif and ankyrin repeat domain-containing protein 2 (Ankyrin repeat domain-containing protein 25) (Matrix-remodeling-associated protein 3) (SRC-1-interacting protein) (SIP) (SRC-interacting protein) (SRC1-interacting protein)

Protein function

Involved in transcription regulation by sequestering in the cytoplasm nuclear receptor coactivators such as NCOA1, NCOA2 and NCOA3 (PubMed:17476305). Involved in regulation of caspase-independent apoptosis by sequestering the proapoptotic factor

PDB

4HBD , 5YBV , 6TMD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12075	KN_motif	31 → 69	KN motif	Motif
PF00023	Ank	666 → 699	Ankyrin repeat	Repeat
PF13637	Ank_4	739 → 792		Repeat
PF12796	Ank_2	764 → 834	Ankyrin repeats (3 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in cervix, colon, heart, kidney and lung. Expressed in kidney glomerular podocytes and mesangial cells (at protein level). {ECO:0000269|PubMed:17996375, ECO:0000269|PubMed:20720434}.

Sequence

MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLR
RVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGF
NPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPP
SAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPT
AGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
QELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAPAQRAQSLEPY
GTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVR
SIMKRKEEVADPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPS
VAEAPQLRPAGTAAAKTSRQECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLA
LEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVV
NIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIE
TVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCAC
EHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD
DESPTSSSAEE

Sequence length

851

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nephrotic syndrome 16	Pathogenic	rs1555816634	RCV000515625	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Wooly hair-palmoplantar keratoderma syndrome	Pathogenic	rs606231303	RCV000145417	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC STEROID-RESISTANT NEPHROTIC SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY STEROID-RESISTANT NEPHROTIC SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KANK2-related disorder	Likely benign; Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME, TYPE 16	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOOLLY HAIR-PALMOPLANTAR KERATODERMA SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOOLY HAIR WITH PALMOPLANTAR KERATODERMA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult type dermatomyositis	Dermatomyositis	BEFREE	21052763, 30398034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28749453, 28984682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28749453, 28984682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20585948, 22037216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29148855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26603518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22480271, 28196083, 29534068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common ventricle	Complete Atrioventricular Canal Defect	BEFREE	28770308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17400182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28984682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	21052763, 30398034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30063800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30063800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24740456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	GWASDB_DG	22968135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31377852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20585948, 22037216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18765951, 21268134, 23463283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18171983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22480271, 28196083, 29534068		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23044150		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	37460977	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28984682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20237793, 22295074, 28870748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	25961457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
NEPHROTIC SYNDROME, TYPE 16	Nephrotic Syndrome	GENOMICS_ENGLAND_DG	25961457		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME, TYPE 16	Nephrotic Syndrome	UNIPROT_DG	25961457		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME, TYPE 16	Nephrotic Syndrome	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	22480271		★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA AND WOOLLY HAIR	Palmoplantar Keratoderma And Woolly Hair	ORPHANET_DG	24671081		★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA AND WOOLLY HAIR	Palmoplantar Keratoderma And Woolly Hair	GENOMICS_ENGLAND_DG	24671081		★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA AND WOOLLY HAIR	Palmoplantar Keratoderma And Woolly Hair	UNIPROT_DG	24671081		★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA AND WOOLLY HAIR	Palmoplantar Keratoderma And Woolly Hair	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PALMOPLANTAR KERATODERMA AND WOOLLY HAIR	Palmoplantar Keratoderma And Woolly Hair	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18765951, 21268134, 23463283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17400182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	35271662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Ventricle Defect	Single Ventricle Defect	BEFREE	28770308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18171983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	29686622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Woolly hair-palmoplantar keratoderma syndrome	Palmoplantar Keratoderma And Woolly Hair	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

KANK2 (KN motif and ankyrin repeat domains 2)