Gene Gene information from NCBI Gene database.
Entrez ID 25946
Gene name Zinc finger protein 385A
Gene symbol ZNF385A
Synonyms (NCBI Gene)
HZFRZFZFP385ZNF385
Chromosome 12
Chromosome location 12q13.13
Summary Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]).[supplied by OMIM, Oct 2008]
miRNA miRNA information provided by mirtarbase database.
581
miRTarBase ID miRNA Experiments Reference
MIRT021123 hsa-miR-186-5p Sequencing 20371350
MIRT045655 hsa-miR-149-5p CLASH 23622248
MIRT463159 hsa-miR-128-3p PAR-CLIP 21572407
MIRT463158 hsa-miR-3681-3p PAR-CLIP 21572407
MIRT463157 hsa-miR-216a-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 17719541
GO:0002039 Function P53 binding IPI 17719541
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22681889
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609124 17521 ENSG00000161642
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96PM9
Protein name Zinc finger protein 385A (Hematopoietic zinc finger protein) (Retinal zinc finger protein)
Protein function RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 74 98 Domain
PF12874 zf-met 201 225 Domain
PF12874 zf-met 261 285 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the retina. {ECO:0000269|PubMed:15527981}.
Sequence
MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSH
TFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREP
GDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGT
PAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKA
YPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRH
KKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGP
PITHPLLHPAPGPIRTAHGPILFSPY
Sequence length 386
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  p53 signaling pathway   TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest
Regulation of TP53 Activity through Association with Co-factors
Transcriptional activation of cell cycle inhibitor p21
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GILLES DE LA TOURETTE SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 36834567 Associate
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 29084334 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 38167072 Associate
★☆☆☆☆
Found in Text Mining only
Hepatitis B Hepatitis b Pubtator 36834567 Stimulate
★☆☆☆☆
Found in Text Mining only
Retinal Diseases Retinal Diseases LHGDN 15527981
★☆☆☆☆
Found in Text Mining only