WWTR1 (WW domain containing transcription regulator 1)

Gene

• Entrez ID: 25937
• Gene name: WW domain containing transcription regulator 1
• Gene symbol: WWTR1
• Synonyms (NCBI Gene): TAZ
• Chromosome: 3
• Chromosome location: 3q25.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016501	hsa-miR-193b-3p	Microarray	20304954
MIRT018450	hsa-miR-335-5p	Microarray	18185580
MIRT050729	hsa-miR-18a-5p	CLASH	23622248
MIRT635038	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT635036	hsa-miR-4746-3p	HITS-CLIP	23824327
MIRT635037	hsa-miR-4284	HITS-CLIP	23824327
MIRT635035	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT635034	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT635033	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT635032	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT635031	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT635030	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT635029	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT635028	hsa-miR-7977	HITS-CLIP	23824327
MIRT635027	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT635026	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT635025	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT635024	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT635023	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT635022	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT635021	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT635020	hsa-miR-3689c	HITS-CLIP	23824327
MIRT635019	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT635018	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT635017	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT635016	hsa-miR-3122	HITS-CLIP	23824327
MIRT635015	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT635014	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT635013	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT550038	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT550037	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT550036	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT550035	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT550034	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT550033	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT550032	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT550031	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550030	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550029	hsa-miR-200a-5p	PAR-CLIP	21572407
MIRT550028	hsa-miR-200b-5p	PAR-CLIP	21572407
MIRT550027	hsa-miR-5682	PAR-CLIP	21572407
MIRT550026	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT550025	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT444523	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT444522	hsa-miR-4635	PAR-CLIP	22100165
MIRT444520	hsa-miR-3148	PAR-CLIP	22100165
MIRT444521	hsa-miR-361-5p	PAR-CLIP	22100165
MIRT444519	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT444518	hsa-miR-374a-3p	PAR-CLIP	22100165
MIRT444523	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT444522	hsa-miR-4635	PAR-CLIP	22100165
MIRT444520	hsa-miR-3148	PAR-CLIP	22100165
MIRT444521	hsa-miR-361-5p	PAR-CLIP	22100165
MIRT444519	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT444518	hsa-miR-374a-3p	PAR-CLIP	22100165
MIRT635038	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT635036	hsa-miR-4746-3p	HITS-CLIP	23824327
MIRT635037	hsa-miR-4284	HITS-CLIP	23824327
MIRT635035	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT635034	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT635033	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT635032	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT635031	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT635030	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT635029	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT635028	hsa-miR-7977	HITS-CLIP	23824327
MIRT635027	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT635026	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT635025	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT635024	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT635023	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT635022	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT635021	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT635020	hsa-miR-3689c	HITS-CLIP	23824327
MIRT635019	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT635018	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT635017	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT635016	hsa-miR-3122	HITS-CLIP	23824327
MIRT635015	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT635014	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT635013	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT550038	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT550037	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT550036	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT550035	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT550034	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT550033	hsa-miR-101-5p	PAR-CLIP	21572407
MIRT550032	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT550031	hsa-miR-5692b	PAR-CLIP	21572407
MIRT550030	hsa-miR-5692c	PAR-CLIP	21572407
MIRT550029	hsa-miR-200a-5p	PAR-CLIP	21572407
MIRT550028	hsa-miR-200b-5p	PAR-CLIP	21572407
MIRT550027	hsa-miR-5682	PAR-CLIP	21572407
MIRT550026	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT550025	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT444523	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT444522	hsa-miR-4635	PAR-CLIP	22100165
MIRT444520	hsa-miR-3148	PAR-CLIP	22100165
MIRT444521	hsa-miR-361-5p	PAR-CLIP	22100165
MIRT444519	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT444518	hsa-miR-374a-3p	PAR-CLIP	22100165
MIRT444523	hsa-miR-873-5p	PAR-CLIP	22100165
MIRT444522	hsa-miR-4635	PAR-CLIP	22100165
MIRT444520	hsa-miR-3148	PAR-CLIP	22100165
MIRT444521	hsa-miR-361-5p	PAR-CLIP	22100165
MIRT444519	hsa-miR-488-3p	PAR-CLIP	22100165
MIRT444518	hsa-miR-374a-3p	PAR-CLIP	22100165
MIRT1495006	hsa-miR-202	CLIP-seq
MIRT1495007	hsa-miR-3144-3p	CLIP-seq
MIRT1495008	hsa-miR-4678	CLIP-seq
MIRT1495009	hsa-miR-532-5p	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT1495011	hsa-miR-146a	CLIP-seq
MIRT1495012	hsa-miR-146b-5p	CLIP-seq
MIRT1495013	hsa-miR-2054	CLIP-seq
MIRT1495014	hsa-miR-223	CLIP-seq
MIRT1495015	hsa-miR-3182	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT1495018	hsa-miR-3919	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT1495020	hsa-miR-4263	CLIP-seq
MIRT1495021	hsa-miR-4697-3p	CLIP-seq
MIRT1495022	hsa-miR-4722-5p	CLIP-seq
MIRT1495023	hsa-miR-4735-5p	CLIP-seq
MIRT1495024	hsa-miR-4753-3p	CLIP-seq
MIRT1495025	hsa-miR-4756-3p	CLIP-seq
MIRT1495026	hsa-miR-4766-3p	CLIP-seq
MIRT1495027	hsa-miR-4768-3p	CLIP-seq
MIRT1495028	hsa-miR-4768-5p	CLIP-seq
MIRT1495029	hsa-miR-4789-5p	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT1495031	hsa-miR-548aa	CLIP-seq
MIRT1495032	hsa-miR-548ac	CLIP-seq
MIRT1495033	hsa-miR-548ae	CLIP-seq
MIRT1495034	hsa-miR-548aj	CLIP-seq
MIRT1495035	hsa-miR-548am	CLIP-seq
MIRT1495036	hsa-miR-548d-3p	CLIP-seq
MIRT1495037	hsa-miR-548x	CLIP-seq
MIRT1495038	hsa-miR-548z	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT1495040	hsa-miR-576-5p	CLIP-seq
MIRT1495041	hsa-miR-589	CLIP-seq
MIRT1495042	hsa-miR-598	CLIP-seq
MIRT1495043	hsa-miR-600	CLIP-seq
MIRT1495044	hsa-miR-622	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT1495046	hsa-miR-1184	CLIP-seq
MIRT1495047	hsa-miR-1205	CLIP-seq
MIRT1495048	hsa-miR-1227	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT1495049	hsa-miR-1245	CLIP-seq
MIRT1495050	hsa-miR-1246	CLIP-seq
MIRT1495051	hsa-miR-1256	CLIP-seq
MIRT1495052	hsa-miR-1258	CLIP-seq
MIRT1495053	hsa-miR-1912	CLIP-seq
MIRT1495054	hsa-miR-23a	CLIP-seq
MIRT1495055	hsa-miR-23b	CLIP-seq
MIRT1495056	hsa-miR-23c	CLIP-seq
MIRT1495057	hsa-miR-2467-3p	CLIP-seq
MIRT1495058	hsa-miR-3134	CLIP-seq
MIRT1495059	hsa-miR-3152-3p	CLIP-seq
MIRT1495060	hsa-miR-3158-5p	CLIP-seq
MIRT1495061	hsa-miR-3194-3p	CLIP-seq
MIRT1495062	hsa-miR-338-3p	CLIP-seq
MIRT1495063	hsa-miR-33a	CLIP-seq
MIRT1495064	hsa-miR-33b	CLIP-seq
MIRT1495065	hsa-miR-3612	CLIP-seq
MIRT1495066	hsa-miR-3662	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT1495067	hsa-miR-376a	CLIP-seq
MIRT1495068	hsa-miR-376b	CLIP-seq
MIRT1495069	hsa-miR-382	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT1495018	hsa-miR-3919	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT1495070	hsa-miR-4257	CLIP-seq
MIRT1495071	hsa-miR-4320	CLIP-seq
MIRT1495072	hsa-miR-4443	CLIP-seq
MIRT1495073	hsa-miR-4496	CLIP-seq
MIRT1495074	hsa-miR-4534	CLIP-seq
MIRT1495075	hsa-miR-4537	CLIP-seq
MIRT1495076	hsa-miR-4712-5p	CLIP-seq
MIRT1495022	hsa-miR-4722-5p	CLIP-seq
MIRT1495025	hsa-miR-4756-3p	CLIP-seq
MIRT1495027	hsa-miR-4768-3p	CLIP-seq
MIRT1495077	hsa-miR-4777-5p	CLIP-seq
MIRT1495078	hsa-miR-4802-5p	CLIP-seq
MIRT1495079	hsa-miR-490-5p	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT1495080	hsa-miR-508-5p	CLIP-seq
MIRT1495081	hsa-miR-522	CLIP-seq
MIRT1495031	hsa-miR-548aa	CLIP-seq
MIRT1495032	hsa-miR-548ac	CLIP-seq
MIRT1495033	hsa-miR-548ae	CLIP-seq
MIRT1495034	hsa-miR-548aj	CLIP-seq
MIRT1495035	hsa-miR-548am	CLIP-seq
MIRT1495036	hsa-miR-548d-3p	CLIP-seq
MIRT1495037	hsa-miR-548x	CLIP-seq
MIRT1495038	hsa-miR-548z	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT1495082	hsa-miR-593	CLIP-seq
MIRT1495083	hsa-miR-650	CLIP-seq
MIRT1495084	hsa-miR-770-5p	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT1555605	hsa-miR-3126-5p	CLIP-seq
MIRT1555606	hsa-miR-3135b	CLIP-seq
MIRT1495069	hsa-miR-382	CLIP-seq
MIRT2149097	hsa-miR-1207-5p	CLIP-seq
MIRT2149098	hsa-miR-1224-5p	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT2149099	hsa-miR-1254	CLIP-seq
MIRT2149100	hsa-miR-1273f	CLIP-seq
MIRT2149101	hsa-miR-1343	CLIP-seq
MIRT2149102	hsa-miR-155	CLIP-seq
MIRT1495053	hsa-miR-1912	CLIP-seq
MIRT2149103	hsa-miR-2052	CLIP-seq
MIRT2149104	hsa-miR-2113	CLIP-seq
MIRT1495057	hsa-miR-2467-3p	CLIP-seq
MIRT2149105	hsa-miR-3074-5p	CLIP-seq
MIRT2149106	hsa-miR-3116	CLIP-seq
MIRT2149107	hsa-miR-3125	CLIP-seq
MIRT2149108	hsa-miR-3137	CLIP-seq
MIRT2149109	hsa-miR-3170	CLIP-seq
MIRT1495063	hsa-miR-33a	CLIP-seq
MIRT1495064	hsa-miR-33b	CLIP-seq
MIRT2149110	hsa-miR-3619-3p	CLIP-seq
MIRT2149111	hsa-miR-3664-5p	CLIP-seq
MIRT2149112	hsa-miR-3665	CLIP-seq
MIRT2149113	hsa-miR-3690	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT2149114	hsa-miR-3915	CLIP-seq
MIRT2149115	hsa-miR-3916	CLIP-seq
MIRT2149116	hsa-miR-3928	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT2149117	hsa-miR-4254	CLIP-seq
MIRT1495070	hsa-miR-4257	CLIP-seq
MIRT2149118	hsa-miR-4260	CLIP-seq
MIRT2149119	hsa-miR-4290	CLIP-seq
MIRT2149120	hsa-miR-4452	CLIP-seq
MIRT2149121	hsa-miR-4494	CLIP-seq
MIRT2149122	hsa-miR-4514	CLIP-seq
MIRT1495075	hsa-miR-4537	CLIP-seq
MIRT2149123	hsa-miR-4638-3p	CLIP-seq
MIRT2149124	hsa-miR-4664-3p	CLIP-seq
MIRT2149125	hsa-miR-4666-5p	CLIP-seq
MIRT2149126	hsa-miR-4680-3p	CLIP-seq
MIRT2149127	hsa-miR-4689	CLIP-seq
MIRT2149128	hsa-miR-4692	CLIP-seq
MIRT2149129	hsa-miR-4714-5p	CLIP-seq
MIRT1495022	hsa-miR-4722-5p	CLIP-seq
MIRT2149130	hsa-miR-4724-5p	CLIP-seq
MIRT2149131	hsa-miR-4736	CLIP-seq
MIRT2149132	hsa-miR-4751	CLIP-seq
MIRT2149133	hsa-miR-4763-3p	CLIP-seq
MIRT1495027	hsa-miR-4768-3p	CLIP-seq
MIRT2149134	hsa-miR-4771	CLIP-seq
MIRT2149135	hsa-miR-4775	CLIP-seq
MIRT2149136	hsa-miR-4776-5p	CLIP-seq
MIRT2149137	hsa-miR-4795-5p	CLIP-seq
MIRT2149138	hsa-miR-4803	CLIP-seq
MIRT2149139	hsa-miR-494	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT1495031	hsa-miR-548aa	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT2149140	hsa-miR-590-3p	CLIP-seq
MIRT2149141	hsa-miR-640	CLIP-seq
MIRT2149142	hsa-miR-764	CLIP-seq
MIRT2149143	hsa-miR-877	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT1495079	hsa-miR-490-5p	CLIP-seq
MIRT1495046	hsa-miR-1184	CLIP-seq
MIRT1495047	hsa-miR-1205	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT1495053	hsa-miR-1912	CLIP-seq
MIRT1495057	hsa-miR-2467-3p	CLIP-seq
MIRT1495060	hsa-miR-3158-5p	CLIP-seq
MIRT2369619	hsa-miR-340	CLIP-seq
MIRT2369620	hsa-miR-3678-3p	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT1495070	hsa-miR-4257	CLIP-seq
MIRT2369621	hsa-miR-4642	CLIP-seq
MIRT1495022	hsa-miR-4722-5p	CLIP-seq
MIRT1495027	hsa-miR-4768-3p	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT2369622	hsa-miR-513b	CLIP-seq
MIRT2369623	hsa-miR-544	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT2369624	hsa-miR-634	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT2149134	hsa-miR-4771	CLIP-seq
MIRT2369622	hsa-miR-513b	CLIP-seq
MIRT2397068	hsa-miR-574-3p	CLIP-seq
MIRT2149097	hsa-miR-1207-5p	CLIP-seq
MIRT2663161	hsa-miR-1208	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT2663162	hsa-miR-1272	CLIP-seq
MIRT2663163	hsa-miR-1278	CLIP-seq
MIRT2663164	hsa-miR-1283	CLIP-seq
MIRT2663165	hsa-miR-147	CLIP-seq
MIRT2663166	hsa-miR-149	CLIP-seq
MIRT1495053	hsa-miR-1912	CLIP-seq
MIRT2663167	hsa-miR-203	CLIP-seq
MIRT2149104	hsa-miR-2113	CLIP-seq
MIRT2663168	hsa-miR-2116	CLIP-seq
MIRT2663169	hsa-miR-2355-3p	CLIP-seq
MIRT2663170	hsa-miR-28-3p	CLIP-seq
MIRT2663171	hsa-miR-298	CLIP-seq
MIRT2663172	hsa-miR-3064-3p	CLIP-seq
MIRT2663173	hsa-miR-3064-5p	CLIP-seq
MIRT2663174	hsa-miR-3119	CLIP-seq
MIRT2663175	hsa-miR-3126-3p	CLIP-seq
MIRT2663176	hsa-miR-3156-5p	CLIP-seq
MIRT2663177	hsa-miR-3163	CLIP-seq
MIRT2149109	hsa-miR-3170	CLIP-seq
MIRT2663178	hsa-miR-338-5p	CLIP-seq
MIRT2369619	hsa-miR-340	CLIP-seq
MIRT2663179	hsa-miR-342-5p	CLIP-seq
MIRT2663180	hsa-miR-3591-5p	CLIP-seq
MIRT2663181	hsa-miR-3607-3p	CLIP-seq
MIRT2663182	hsa-miR-3613-3p	CLIP-seq
MIRT2663183	hsa-miR-3646	CLIP-seq
MIRT2663184	hsa-miR-3647-3p	CLIP-seq
MIRT2663185	hsa-miR-3650	CLIP-seq
MIRT2663186	hsa-miR-3653	CLIP-seq
MIRT1495066	hsa-miR-3662	CLIP-seq
MIRT2149112	hsa-miR-3665	CLIP-seq
MIRT2369620	hsa-miR-3678-3p	CLIP-seq
MIRT2663187	hsa-miR-3682-3p	CLIP-seq
MIRT2663188	hsa-miR-3682-5p	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT2663189	hsa-miR-371b-5p	CLIP-seq
MIRT2663190	hsa-miR-374a	CLIP-seq
MIRT2663191	hsa-miR-374b	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT2663192	hsa-miR-3911	CLIP-seq
MIRT2663193	hsa-miR-3921	CLIP-seq
MIRT2663194	hsa-miR-3922-5p	CLIP-seq
MIRT2663195	hsa-miR-3923	CLIP-seq
MIRT2663196	hsa-miR-3942-3p	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT2663197	hsa-miR-4252	CLIP-seq
MIRT2663198	hsa-miR-4255	CLIP-seq
MIRT2149118	hsa-miR-4260	CLIP-seq
MIRT1495020	hsa-miR-4263	CLIP-seq
MIRT2663199	hsa-miR-4282	CLIP-seq
MIRT2663200	hsa-miR-4307	CLIP-seq
MIRT2663201	hsa-miR-4327	CLIP-seq
MIRT2663202	hsa-miR-4457	CLIP-seq
MIRT2663203	hsa-miR-4474-3p	CLIP-seq
MIRT1495073	hsa-miR-4496	CLIP-seq
MIRT2663204	hsa-miR-4651	CLIP-seq
MIRT2663205	hsa-miR-4653-5p	CLIP-seq
MIRT2663206	hsa-miR-4664-5p	CLIP-seq
MIRT2663207	hsa-miR-4677-5p	CLIP-seq
MIRT2663208	hsa-miR-4684-5p	CLIP-seq
MIRT2663209	hsa-miR-4698	CLIP-seq
MIRT2663210	hsa-miR-4699-3p	CLIP-seq
MIRT2663211	hsa-miR-4715-3p	CLIP-seq
MIRT1495022	hsa-miR-4722-5p	CLIP-seq
MIRT2149131	hsa-miR-4736	CLIP-seq
MIRT2663212	hsa-miR-4738-3p	CLIP-seq
MIRT2663213	hsa-miR-4744	CLIP-seq
MIRT1495024	hsa-miR-4753-3p	CLIP-seq
MIRT2663214	hsa-miR-4753-5p	CLIP-seq
MIRT2663215	hsa-miR-4760-5p	CLIP-seq
MIRT2149133	hsa-miR-4763-3p	CLIP-seq
MIRT2663216	hsa-miR-4766-5p	CLIP-seq
MIRT1495027	hsa-miR-4768-3p	CLIP-seq
MIRT1495028	hsa-miR-4768-5p	CLIP-seq
MIRT2663217	hsa-miR-4781-3p	CLIP-seq
MIRT2663218	hsa-miR-4794	CLIP-seq
MIRT2663219	hsa-miR-4799-5p	CLIP-seq
MIRT2663220	hsa-miR-488	CLIP-seq
MIRT2663221	hsa-miR-490-3p	CLIP-seq
MIRT2663222	hsa-miR-495	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT2369622	hsa-miR-513b	CLIP-seq
MIRT2663223	hsa-miR-520f	CLIP-seq
MIRT1495032	hsa-miR-548ac	CLIP-seq
MIRT1495033	hsa-miR-548ae	CLIP-seq
MIRT1495034	hsa-miR-548aj	CLIP-seq
MIRT1495035	hsa-miR-548am	CLIP-seq
MIRT2663224	hsa-miR-548c-3p	CLIP-seq
MIRT1495036	hsa-miR-548d-3p	CLIP-seq
MIRT2663225	hsa-miR-548g	CLIP-seq
MIRT2663226	hsa-miR-548u	CLIP-seq
MIRT1495037	hsa-miR-548x	CLIP-seq
MIRT1495038	hsa-miR-548z	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT1495040	hsa-miR-576-5p	CLIP-seq
MIRT2663227	hsa-miR-579	CLIP-seq
MIRT2663228	hsa-miR-582-5p	CLIP-seq
MIRT2663229	hsa-miR-583	CLIP-seq
MIRT2663230	hsa-miR-584	CLIP-seq
MIRT1495043	hsa-miR-600	CLIP-seq
MIRT2663231	hsa-miR-604	CLIP-seq
MIRT2663232	hsa-miR-607	CLIP-seq
MIRT2663233	hsa-miR-608	CLIP-seq
MIRT2663234	hsa-miR-644	CLIP-seq
MIRT2663235	hsa-miR-647	CLIP-seq
MIRT2663236	hsa-miR-649	CLIP-seq
MIRT2663237	hsa-miR-663b	CLIP-seq
MIRT2663238	hsa-miR-676	CLIP-seq
MIRT2663239	hsa-miR-759	CLIP-seq
MIRT2149142	hsa-miR-764	CLIP-seq
MIRT2663240	hsa-miR-873	CLIP-seq
MIRT2663241	hsa-miR-888	CLIP-seq
MIRT2663242	hsa-miR-892a	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT2663243	hsa-miR-944	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT2663172	hsa-miR-3064-3p	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT2149097	hsa-miR-1207-5p	CLIP-seq
MIRT2663161	hsa-miR-1208	CLIP-seq
MIRT1495010	hsa-miR-124	CLIP-seq
MIRT2695343	hsa-miR-1248	CLIP-seq
MIRT2663162	hsa-miR-1272	CLIP-seq
MIRT2663163	hsa-miR-1278	CLIP-seq
MIRT2663164	hsa-miR-1283	CLIP-seq
MIRT2663165	hsa-miR-147	CLIP-seq
MIRT2663166	hsa-miR-149	CLIP-seq
MIRT2695344	hsa-miR-188-3p	CLIP-seq
MIRT2695345	hsa-miR-18a	CLIP-seq
MIRT2695346	hsa-miR-18b	CLIP-seq
MIRT2663167	hsa-miR-203	CLIP-seq
MIRT2149104	hsa-miR-2113	CLIP-seq
MIRT2663168	hsa-miR-2116	CLIP-seq
MIRT2663169	hsa-miR-2355-3p	CLIP-seq
MIRT2663171	hsa-miR-298	CLIP-seq
MIRT2695347	hsa-miR-29a	CLIP-seq
MIRT2695348	hsa-miR-29b	CLIP-seq
MIRT2695349	hsa-miR-29c	CLIP-seq
MIRT2663172	hsa-miR-3064-3p	CLIP-seq
MIRT2663173	hsa-miR-3064-5p	CLIP-seq
MIRT2663174	hsa-miR-3119	CLIP-seq
MIRT2663175	hsa-miR-3126-3p	CLIP-seq
MIRT2663176	hsa-miR-3156-5p	CLIP-seq
MIRT2663177	hsa-miR-3163	CLIP-seq
MIRT2149109	hsa-miR-3170	CLIP-seq
MIRT2663178	hsa-miR-338-5p	CLIP-seq
MIRT2369619	hsa-miR-340	CLIP-seq
MIRT2663179	hsa-miR-342-5p	CLIP-seq
MIRT2663180	hsa-miR-3591-5p	CLIP-seq
MIRT2663182	hsa-miR-3613-3p	CLIP-seq
MIRT2695350	hsa-miR-3614-3p	CLIP-seq
MIRT2663183	hsa-miR-3646	CLIP-seq
MIRT2663184	hsa-miR-3647-3p	CLIP-seq
MIRT2663185	hsa-miR-3650	CLIP-seq
MIRT2663186	hsa-miR-3653	CLIP-seq
MIRT1495066	hsa-miR-3662	CLIP-seq
MIRT2149112	hsa-miR-3665	CLIP-seq
MIRT2369620	hsa-miR-3678-3p	CLIP-seq
MIRT2663187	hsa-miR-3682-3p	CLIP-seq
MIRT2663188	hsa-miR-3682-5p	CLIP-seq
MIRT1495016	hsa-miR-3714	CLIP-seq
MIRT2663189	hsa-miR-371b-5p	CLIP-seq
MIRT2663190	hsa-miR-374a	CLIP-seq
MIRT2663191	hsa-miR-374b	CLIP-seq
MIRT1495017	hsa-miR-3910	CLIP-seq
MIRT2663192	hsa-miR-3911	CLIP-seq
MIRT2663193	hsa-miR-3921	CLIP-seq
MIRT2663194	hsa-miR-3922-5p	CLIP-seq
MIRT2663195	hsa-miR-3923	CLIP-seq
MIRT2663196	hsa-miR-3942-3p	CLIP-seq
MIRT1495019	hsa-miR-3975	CLIP-seq
MIRT2663197	hsa-miR-4252	CLIP-seq
MIRT2663198	hsa-miR-4255	CLIP-seq
MIRT2149118	hsa-miR-4260	CLIP-seq
MIRT1495020	hsa-miR-4263	CLIP-seq
MIRT2663199	hsa-miR-4282	CLIP-seq
MIRT2663200	hsa-miR-4307	CLIP-seq
MIRT2663201	hsa-miR-4327	CLIP-seq
MIRT2663202	hsa-miR-4457	CLIP-seq
MIRT2663203	hsa-miR-4474-3p	CLIP-seq
MIRT1495073	hsa-miR-4496	CLIP-seq
MIRT2695351	hsa-miR-4646-3p	CLIP-seq
MIRT2663204	hsa-miR-4651	CLIP-seq
MIRT2663205	hsa-miR-4653-5p	CLIP-seq
MIRT2695352	hsa-miR-4659a-3p	CLIP-seq
MIRT2695353	hsa-miR-4659b-3p	CLIP-seq
MIRT2663206	hsa-miR-4664-5p	CLIP-seq
MIRT2663207	hsa-miR-4677-5p	CLIP-seq
MIRT2663208	hsa-miR-4684-5p	CLIP-seq
MIRT2663209	hsa-miR-4698	CLIP-seq
MIRT2663210	hsa-miR-4699-3p	CLIP-seq
MIRT2663211	hsa-miR-4715-3p	CLIP-seq
MIRT2695354	hsa-miR-4735-3p	CLIP-seq
MIRT2149131	hsa-miR-4736	CLIP-seq
MIRT2663213	hsa-miR-4744	CLIP-seq
MIRT2663214	hsa-miR-4753-5p	CLIP-seq
MIRT2663215	hsa-miR-4760-5p	CLIP-seq
MIRT2149133	hsa-miR-4763-3p	CLIP-seq
MIRT2663216	hsa-miR-4766-5p	CLIP-seq
MIRT2663217	hsa-miR-4781-3p	CLIP-seq
MIRT2663218	hsa-miR-4794	CLIP-seq
MIRT2695355	hsa-miR-4797-5p	CLIP-seq
MIRT2663220	hsa-miR-488	CLIP-seq
MIRT2663222	hsa-miR-495	CLIP-seq
MIRT1495030	hsa-miR-506	CLIP-seq
MIRT2369622	hsa-miR-513b	CLIP-seq
MIRT2663223	hsa-miR-520f	CLIP-seq
MIRT2695356	hsa-miR-532-3p	CLIP-seq
MIRT1495032	hsa-miR-548ac	CLIP-seq
MIRT1495033	hsa-miR-548ae	CLIP-seq
MIRT1495034	hsa-miR-548aj	CLIP-seq
MIRT1495035	hsa-miR-548am	CLIP-seq
MIRT1495036	hsa-miR-548d-3p	CLIP-seq
MIRT2663226	hsa-miR-548u	CLIP-seq
MIRT1495037	hsa-miR-548x	CLIP-seq
MIRT1495038	hsa-miR-548z	CLIP-seq
MIRT1495039	hsa-miR-550a	CLIP-seq
MIRT1495040	hsa-miR-576-5p	CLIP-seq
MIRT2663228	hsa-miR-582-5p	CLIP-seq
MIRT2663230	hsa-miR-584	CLIP-seq
MIRT2663231	hsa-miR-604	CLIP-seq
MIRT2663232	hsa-miR-607	CLIP-seq
MIRT2663233	hsa-miR-608	CLIP-seq
MIRT2663234	hsa-miR-644	CLIP-seq
MIRT2663235	hsa-miR-647	CLIP-seq
MIRT2663237	hsa-miR-663b	CLIP-seq
MIRT2663238	hsa-miR-676	CLIP-seq
MIRT2663239	hsa-miR-759	CLIP-seq
MIRT2149142	hsa-miR-764	CLIP-seq
MIRT2695357	hsa-miR-767-5p	CLIP-seq
MIRT2663240	hsa-miR-873	CLIP-seq
MIRT2663241	hsa-miR-888	CLIP-seq
MIRT2663242	hsa-miR-892a	CLIP-seq
MIRT2695358	hsa-miR-924	CLIP-seq
MIRT1495045	hsa-miR-940	CLIP-seq
MIRT2663243	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0003015	Process	Heart process	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	19010321
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	19010321
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	23911299
GO:0003713	Function	Transcription coactivator activity	NAS	11118213
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	16099986, 16189514, 18227151, 18568018, 19010321, 19324877, 20412773, 20594350, 20936779, 20972459, 21145499, 21205866, 22078877, 22234184, 23245942, 23873930, 23911299, 28514442, 30126976, 31515488, 32296183, 33961781, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19010321
GO:0005634	Component	Nucleus	IDA	18568018, 21145499, 23911299, 25849865
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11118213
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20412773, 23911299, 25849865
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11118213
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	18227151
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	18227151
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0017145	Process	Stem cell division	IDA	18568018
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032835	Process	Glomerulus development	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0035329	Process	Hippo signaling	IBA
GO:0035329	Process	Hippo signaling	IDA	18227151, 20412773, 35429439
GO:0035329	Process	Hippo signaling	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IGI	29496737
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IGI	29496737
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	18568018
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IEA
GO:0060993	Process	Kidney morphogenesis	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20412773
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	ISS

Other IDs

• MIM: 607392
• HGNC: 24042
• e!Ensembl: ENSG00000018408

Protein

• UniProt ID: Q9GZV5
• Protein name: WW domain-containing transcription regulator protein 1 (Transcriptional coactivator with PDZ-binding motif)
• Protein function: Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:11118213,
• PDB: 5N5R, 5N5T, 5N5W, 5N75, 6RHC, 6RJL, 6RJQ, 6RP6, 6SLW, 6SLX, 8R0Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00397	WW	126 → 155	WW domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in kidney, heart, placenta and lung. Expressed in the thyroid tissue. {ECO:0000269|PubMed:11118213, ECO:0000269|PubMed:19010321}.
• Sequence:

  MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
  HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
  TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
  SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
  QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
  NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
  LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL

• Sequence length: 400

Pathways

KEGG:

Hippo signaling pathway
Hippo signaling pathway - multiple species

Reactome:

Signaling by Hippo
YAP1- and WWTR1 (TAZ)-stimulated gene expression
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
Physiological factors
RUNX3 regulates YAP1-mediated transcription
EGR2 and SOX10-mediated initiation of Schwann cell myelination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA, ALVEOLAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	23361305, 37186429	Associate	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24707483		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29042987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28368399, 28737828		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	31494105		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	CTD_human_DG	31494105		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	31074490		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31057295		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	28183324	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30466081		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33145365, 35941675	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30466081		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27583562	Associate	★☆☆☆☆ Found in Text Mining only
Barth Syndrome	Barth syndrome	Pubtator	12930833, 14651618, 15304507, 15806137, 16235007, 16873891, 17043667, 17241629, 17394203, 18799610, 19244244, 22023389, 23031367, 23100323, 23345479, 23361305, 23409742, 23523468, 23656970, 23678274, 24078306, 24318983, 24813252, 25112388, 25776009, 25782672, 26845103, 28183324, 29563154, 30002286, 30251684, 30649188, 31336787, 33077895, 33096711, 34355125, 34382226, 35676289, 35732368, 36219982, 36628843, 37186429, 39757347, 40555742, 9345098, 9792874	Associate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30121256		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30907511		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21258416, 22717556, 23566416, 25417742, 26506596, 29545474, 30559289, 31081045, 31360073		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19324876, 24648515, 25294813, 25417742, 25670202, 26059435, 26265440, 26885614, 27039292, 27094683, 27797825, 29661856, 29847788, 30450766, 31015482, 31081045, 32019974, 32329855, 33167967, 33230261, 34463254, 34488828, 35064101, 35178446, 35231654, 36308078, 36309401, 36598329, 36609396, 38565949	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	27248471, 27713571, 27987320	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	33903236, 37150829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18227151, 19324876, 21584898, 24858921, 24860833, 25670202, 25995450, 26885614, 28055015, 28249901, 29065973, 29183995, 29970086, 30158528, 31015482, 31743393, 31880317, 32203417, 33296708, 35411948, 36308276, 36598329, 36609396, 37544381	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	27129148	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	36788083	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27248471	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24860833, 26125451, 27881216, 34565286, 34664408, 37041150, 37366601, 38242197	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	36719743	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21258416, 22470139, 23959471, 28368399, 28737828, 29339539		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36247876	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28381547, 31358620, 36536047, 38247878	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35411948, 35942760	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19262106, 33903236, 37150829	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23942151, 25895125		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	23361305, 23656970, 28183324, 36219982, 36628843	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	11896212, 17394203, 23345479, 29071820, 30122738, 33096711	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	28498465	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	28498465	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37443201	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30717258		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34615513	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27129148	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	Choreoathetosis, Hypothyroidism, And Neonatal Respiratory Distress	BEFREE	29294041		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	34615513	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29298862		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31087761		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23762387, 27717711, 28946619		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22470139, 23762387, 31782506		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23372686, 24976283, 26370619, 27527859, 28249901, 33879786, 36781122	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	18799610	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30717258		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	34615513	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37443201	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29298862		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30094836		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	34314685	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	27184927		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35429182	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23942151		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	21584898, 21885404, 22429593, 23737213, 25353289, 25680571, 25817592, 25961935, 26050962, 26763770, 26811225, 26840265, 28598585, 28855107, 30085199, 31537895		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	ORPHANET_DG	24986479		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	Orphanet			★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35930163, 40295580	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35930163	Associate	★☆☆☆☆ Found in Text Mining only
Familial isolated dilated cardiomyopathy	Dilated Cardiomyopathy	Orphanet			★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31087761	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28068223, 30964207, 31087761		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	30976198		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	23258147, 29115373, 30025139		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22190458, 26241672, 27764783, 29890731, 30542117		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30759398, 36308276, 37083045, 37427593, 37434432	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22190458, 26241672, 27764783, 29890731, 30542117		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22190458, 27764783, 27852048, 27852064, 31209945		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27852048	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	37565816	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	35732368	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24813252	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32170768	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	19244244, 28855170, 37186429	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	25353289	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	26763770		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	31743393	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25294813	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29088718		★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	28502290	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22825057	Associate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	32289280	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	18227151	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36077517	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36077517	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28195168		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32289280	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	27554639		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	34565020	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35985686	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33061801	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	27129148	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	31074490		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	27129148		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25495189, 25650113, 26125451, 26389641, 27734263, 29115596, 30717258, 31576176		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31087761		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	29071820	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23959471	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27797825, 31746077, 32297484, 32361707, 32816858, 33296708, 33903236, 37150829	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24175801, 24858921	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	27129148		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22190458, 27764783, 31209945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21258416, 22717556, 23566416, 25417742, 26506596, 29545474, 30559289, 31081045, 31360073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30717258, 30881030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21258416, 22470139, 23959471, 28368399, 28737828, 29339539		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23942151, 25895125, 31641008		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26416426, 29399068, 31057295, 31262852		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28408625, 31018586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28279717		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25633292, 29207147		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25592648, 25650113, 25961935, 26389641, 26416426, 26561204, 26758663, 28035075, 28820389, 28925394, 29115596, 29212185, 29339539, 29642615, 30628704, 31018586, 31050214, 31058846, 31308148, 31360073, 31494105		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23762387, 27717711, 28946619		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18413727		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30250159		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26668268, 29970086, 30558661, 34819356, 35798875	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30662519		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29212185		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36740402, 37165917	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	36740402	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	15304507, 23523468, 33096711	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	37150829	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31743393, 37539777	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33833274, 35905688	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	11896212, 23345479	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37382248	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28749195	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21258416, 22190458, 22470139, 23762387, 25633292, 25650113, 25895125, 26125451, 26389641, 26758663, 28430338, 28823959, 29042987, 29115596, 29339539, 29372848, 30250159, 30829729, 31537895, 31579068, 31641008		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	28430338		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25354978, 33452207, 36882436	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28599430		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	33872989	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	35525891	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30964207		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21258416, 23959471, 24951773		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28068223		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis Imperfecta	BEFREE	29401582		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28886519		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27608849, 29933048, 31542501, 35284040, 38071381	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28055015, 28823959		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23942151, 25895125		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33707306, 35053353	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26416426, 29399068, 31057295, 31262852		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	26416426		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21071578, 31358620, 34644566, 36536047	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29399161		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	19273592		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	20833712		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32289280	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Poroma	Poroma	BEFREE	31145701		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28408625, 31018586		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29143545, 32633347, 36254631, 37385752	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30333225		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	26464030	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	27094723		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	36232302	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	27129148, 31880317, 35429182	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	31880317	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	36920288	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27627196		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31360073		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32990596, 35048635, 35931679	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31817001		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30964207, 31087761		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25633292, 29207147		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24175801, 29402328, 30180862	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29207147	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	35397626	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	19542741		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27026033		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27039292, 27485598, 28248929, 31235595, 34488828, 36738577, 38164185	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30250159		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33184436	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31675687	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33798262, 35332245, 37467061	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30388809	Associate	★☆☆☆☆ Found in Text Mining only