Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25897
Gene name	Ring finger protein 19A, RBR E3 ubiquitin protein ligase
Gene symbol	RNF19A
Synonyms (NCBI Gene)	RNF19
Chromosome	8
Chromosome location	8q22.2
Summary	This gene encodes a member of the ring between ring fingers (RBR) protein family, and the encoded protein contains two RING-finger motifs and an in between RING fingers motif. This protein is an E3 ubiquitin ligase that is localized to Lewy bodies, and ub

396

Show/Hide all (396)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020414	hsa-miR-29c-3p	Sequencing	20371350
MIRT028218	hsa-miR-33a-5p	Sequencing	20371350
MIRT040088	hsa-miR-615-3p	CLASH	23622248
MIRT1311729	hsa-miR-103a	CLIP-seq
MIRT1311730	hsa-miR-107	CLIP-seq
MIRT1311731	hsa-miR-1178	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT1311733	hsa-miR-1205	CLIP-seq
MIRT1311734	hsa-miR-129-5p	CLIP-seq
MIRT1311735	hsa-miR-199a-3p	CLIP-seq
MIRT1311736	hsa-miR-199b-3p	CLIP-seq
MIRT1311737	hsa-miR-200b	CLIP-seq
MIRT1311738	hsa-miR-200c	CLIP-seq
MIRT1311739	hsa-miR-2054	CLIP-seq
MIRT1311740	hsa-miR-29a	CLIP-seq
MIRT1311741	hsa-miR-29b	CLIP-seq
MIRT1311742	hsa-miR-29c	CLIP-seq
MIRT1311743	hsa-miR-3115	CLIP-seq
MIRT1311744	hsa-miR-3129-3p	CLIP-seq
MIRT1311745	hsa-miR-3129-5p	CLIP-seq
MIRT1311746	hsa-miR-3156-5p	CLIP-seq
MIRT1311747	hsa-miR-3158-5p	CLIP-seq
MIRT1311748	hsa-miR-3613-5p	CLIP-seq
MIRT1311749	hsa-miR-3614-3p	CLIP-seq
MIRT1311750	hsa-miR-3659	CLIP-seq
MIRT1311751	hsa-miR-376a	CLIP-seq
MIRT1311752	hsa-miR-376b	CLIP-seq
MIRT1311753	hsa-miR-3973	CLIP-seq
MIRT1311754	hsa-miR-425	CLIP-seq
MIRT1311755	hsa-miR-4267	CLIP-seq
MIRT1311756	hsa-miR-429	CLIP-seq
MIRT1311757	hsa-miR-4291	CLIP-seq
MIRT1311758	hsa-miR-4293	CLIP-seq
MIRT1311759	hsa-miR-4310	CLIP-seq
MIRT1311760	hsa-miR-4312	CLIP-seq
MIRT1311761	hsa-miR-4477a	CLIP-seq
MIRT1311762	hsa-miR-4658	CLIP-seq
MIRT1311763	hsa-miR-4678	CLIP-seq
MIRT1311764	hsa-miR-4703-3p	CLIP-seq
MIRT1311765	hsa-miR-4711-3p	CLIP-seq
MIRT1311766	hsa-miR-4729	CLIP-seq
MIRT1311767	hsa-miR-4778-5p	CLIP-seq
MIRT1311768	hsa-miR-4797-3p	CLIP-seq
MIRT1311769	hsa-miR-511	CLIP-seq
MIRT1311770	hsa-miR-520g	CLIP-seq
MIRT1311771	hsa-miR-520h	CLIP-seq
MIRT1311772	hsa-miR-522	CLIP-seq
MIRT1311773	hsa-miR-532-5p	CLIP-seq
MIRT1311774	hsa-miR-544	CLIP-seq
MIRT1311775	hsa-miR-561	CLIP-seq
MIRT1311776	hsa-miR-574-3p	CLIP-seq
MIRT1311777	hsa-miR-574-5p	CLIP-seq
MIRT1311778	hsa-miR-607	CLIP-seq
MIRT1311779	hsa-miR-628-5p	CLIP-seq
MIRT1311780	hsa-miR-642b	CLIP-seq
MIRT1311781	hsa-miR-767-5p	CLIP-seq
MIRT1311782	hsa-miR-9	CLIP-seq
MIRT1311783	hsa-miR-936	CLIP-seq
MIRT1311784	hsa-miR-944	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT2092673	hsa-miR-1256	CLIP-seq
MIRT2092674	hsa-miR-3134	CLIP-seq
MIRT2092675	hsa-miR-3185	CLIP-seq
MIRT2092676	hsa-miR-3609	CLIP-seq
MIRT2092677	hsa-miR-3661	CLIP-seq
MIRT2092678	hsa-miR-4255	CLIP-seq
MIRT2092679	hsa-miR-4418	CLIP-seq
MIRT2092680	hsa-miR-4534	CLIP-seq
MIRT2092681	hsa-miR-4535	CLIP-seq
MIRT2092682	hsa-miR-4641	CLIP-seq
MIRT2092683	hsa-miR-4668-5p	CLIP-seq
MIRT2092684	hsa-miR-4690-3p	CLIP-seq
MIRT2092685	hsa-miR-492	CLIP-seq
MIRT2092686	hsa-miR-509-3-5p	CLIP-seq
MIRT2092687	hsa-miR-509-5p	CLIP-seq
MIRT2092688	hsa-miR-548ah	CLIP-seq
MIRT2092689	hsa-miR-548t	CLIP-seq
MIRT2092690	hsa-miR-631	CLIP-seq
MIRT2092691	hsa-miR-7	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT1311766	hsa-miR-4729	CLIP-seq
MIRT2317102	hsa-miR-101	CLIP-seq
MIRT1311729	hsa-miR-103a	CLIP-seq
MIRT1311730	hsa-miR-107	CLIP-seq
MIRT1311731	hsa-miR-1178	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT1311733	hsa-miR-1205	CLIP-seq
MIRT2317103	hsa-miR-1207-3p	CLIP-seq
MIRT2317104	hsa-miR-1253	CLIP-seq
MIRT2092673	hsa-miR-1256	CLIP-seq
MIRT2317105	hsa-miR-1270	CLIP-seq
MIRT2317106	hsa-miR-132	CLIP-seq
MIRT2317107	hsa-miR-138	CLIP-seq
MIRT2317108	hsa-miR-154	CLIP-seq
MIRT2317109	hsa-miR-188-5p	CLIP-seq
MIRT2317110	hsa-miR-19a	CLIP-seq
MIRT2317111	hsa-miR-19b	CLIP-seq
MIRT2317112	hsa-miR-212	CLIP-seq
MIRT2317113	hsa-miR-2682	CLIP-seq
MIRT2317114	hsa-miR-3064-3p	CLIP-seq
MIRT1311743	hsa-miR-3115	CLIP-seq
MIRT2317115	hsa-miR-3119	CLIP-seq
MIRT2092674	hsa-miR-3134	CLIP-seq
MIRT2317116	hsa-miR-3140-3p	CLIP-seq
MIRT1311747	hsa-miR-3158-5p	CLIP-seq
MIRT2092675	hsa-miR-3185	CLIP-seq
MIRT2317117	hsa-miR-3187-3p	CLIP-seq
MIRT2317118	hsa-miR-34c-3p	CLIP-seq
MIRT2092676	hsa-miR-3609	CLIP-seq
MIRT1311748	hsa-miR-3613-5p	CLIP-seq
MIRT2092677	hsa-miR-3661	CLIP-seq
MIRT2317119	hsa-miR-382	CLIP-seq
MIRT2317120	hsa-miR-3924	CLIP-seq
MIRT2317121	hsa-miR-3926	CLIP-seq
MIRT1311753	hsa-miR-3973	CLIP-seq
MIRT2092678	hsa-miR-4255	CLIP-seq
MIRT1311755	hsa-miR-4267	CLIP-seq
MIRT1311759	hsa-miR-4310	CLIP-seq
MIRT1311760	hsa-miR-4312	CLIP-seq
MIRT2092679	hsa-miR-4418	CLIP-seq
MIRT2317122	hsa-miR-4434	CLIP-seq
MIRT2317123	hsa-miR-4435	CLIP-seq
MIRT2317124	hsa-miR-4438	CLIP-seq
MIRT2317125	hsa-miR-4490	CLIP-seq
MIRT2317126	hsa-miR-449c	CLIP-seq
MIRT2317127	hsa-miR-4514	CLIP-seq
MIRT2317128	hsa-miR-4516	CLIP-seq
MIRT2317129	hsa-miR-4531	CLIP-seq
MIRT2092680	hsa-miR-4534	CLIP-seq
MIRT2092681	hsa-miR-4535	CLIP-seq
MIRT2092682	hsa-miR-4641	CLIP-seq
MIRT2092683	hsa-miR-4668-5p	CLIP-seq
MIRT2317130	hsa-miR-4686	CLIP-seq
MIRT2092684	hsa-miR-4690-3p	CLIP-seq
MIRT2317131	hsa-miR-4692	CLIP-seq
MIRT2317132	hsa-miR-4700-3p	CLIP-seq
MIRT2317133	hsa-miR-4701-5p	CLIP-seq
MIRT1311764	hsa-miR-4703-3p	CLIP-seq
MIRT2317134	hsa-miR-4717-3p	CLIP-seq
MIRT2317135	hsa-miR-4720-3p	CLIP-seq
MIRT2317136	hsa-miR-4724-3p	CLIP-seq
MIRT1311766	hsa-miR-4729	CLIP-seq
MIRT1311767	hsa-miR-4778-5p	CLIP-seq
MIRT2317137	hsa-miR-4804-3p	CLIP-seq
MIRT2317138	hsa-miR-490-3p	CLIP-seq
MIRT2092685	hsa-miR-492	CLIP-seq
MIRT2092686	hsa-miR-509-3-5p	CLIP-seq
MIRT2317139	hsa-miR-5095	CLIP-seq
MIRT2092687	hsa-miR-509-5p	CLIP-seq
MIRT1311770	hsa-miR-520g	CLIP-seq
MIRT1311771	hsa-miR-520h	CLIP-seq
MIRT1311772	hsa-miR-522	CLIP-seq
MIRT1311773	hsa-miR-532-5p	CLIP-seq
MIRT1311774	hsa-miR-544	CLIP-seq
MIRT2317140	hsa-miR-548a-3p	CLIP-seq
MIRT2317141	hsa-miR-548ae	CLIP-seq
MIRT2092688	hsa-miR-548ah	CLIP-seq
MIRT2317142	hsa-miR-548aj	CLIP-seq
MIRT2317143	hsa-miR-548am	CLIP-seq
MIRT2317144	hsa-miR-548e	CLIP-seq
MIRT2317145	hsa-miR-548f	CLIP-seq
MIRT2317146	hsa-miR-548p	CLIP-seq
MIRT2317147	hsa-miR-548s	CLIP-seq
MIRT2092689	hsa-miR-548t	CLIP-seq
MIRT2317148	hsa-miR-548x	CLIP-seq
MIRT2317149	hsa-miR-556-5p	CLIP-seq
MIRT2317150	hsa-miR-588	CLIP-seq
MIRT1311778	hsa-miR-607	CLIP-seq
MIRT2317151	hsa-miR-620	CLIP-seq
MIRT2317152	hsa-miR-626	CLIP-seq
MIRT1311779	hsa-miR-628-5p	CLIP-seq
MIRT2092690	hsa-miR-631	CLIP-seq
MIRT2317153	hsa-miR-649	CLIP-seq
MIRT2092691	hsa-miR-7	CLIP-seq
MIRT2317154	hsa-miR-941	CLIP-seq
MIRT1311784	hsa-miR-944	CLIP-seq
MIRT2317102	hsa-miR-101	CLIP-seq
MIRT2317113	hsa-miR-2682	CLIP-seq
MIRT1311748	hsa-miR-3613-5p	CLIP-seq
MIRT2092677	hsa-miR-3661	CLIP-seq
MIRT2393829	hsa-miR-3671	CLIP-seq
MIRT2092678	hsa-miR-4255	CLIP-seq
MIRT1311755	hsa-miR-4267	CLIP-seq
MIRT2317124	hsa-miR-4438	CLIP-seq
MIRT2317126	hsa-miR-449c	CLIP-seq
MIRT2317127	hsa-miR-4514	CLIP-seq
MIRT2092681	hsa-miR-4535	CLIP-seq
MIRT2317131	hsa-miR-4692	CLIP-seq
MIRT1311764	hsa-miR-4703-3p	CLIP-seq
MIRT1311767	hsa-miR-4778-5p	CLIP-seq
MIRT2092685	hsa-miR-492	CLIP-seq
MIRT2317139	hsa-miR-5095	CLIP-seq
MIRT2317140	hsa-miR-548a-3p	CLIP-seq
MIRT2317144	hsa-miR-548e	CLIP-seq
MIRT2317145	hsa-miR-548f	CLIP-seq
MIRT2092690	hsa-miR-631	CLIP-seq
MIRT1311784	hsa-miR-944	CLIP-seq
MIRT2317102	hsa-miR-101	CLIP-seq
MIRT2317106	hsa-miR-132	CLIP-seq
MIRT2317112	hsa-miR-212	CLIP-seq
MIRT2317113	hsa-miR-2682	CLIP-seq
MIRT2317117	hsa-miR-3187-3p	CLIP-seq
MIRT2317121	hsa-miR-3926	CLIP-seq
MIRT2317123	hsa-miR-4435	CLIP-seq
MIRT2317124	hsa-miR-4438	CLIP-seq
MIRT2317126	hsa-miR-449c	CLIP-seq
MIRT2317127	hsa-miR-4514	CLIP-seq
MIRT2317131	hsa-miR-4692	CLIP-seq
MIRT2317133	hsa-miR-4701-5p	CLIP-seq
MIRT2317139	hsa-miR-5095	CLIP-seq
MIRT2317147	hsa-miR-548s	CLIP-seq
MIRT2317150	hsa-miR-588	CLIP-seq
MIRT2317102	hsa-miR-101	CLIP-seq
MIRT1311729	hsa-miR-103a	CLIP-seq
MIRT1311730	hsa-miR-107	CLIP-seq
MIRT1311731	hsa-miR-1178	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT1311733	hsa-miR-1205	CLIP-seq
MIRT2317103	hsa-miR-1207-3p	CLIP-seq
MIRT2092673	hsa-miR-1256	CLIP-seq
MIRT2317106	hsa-miR-132	CLIP-seq
MIRT2317107	hsa-miR-138	CLIP-seq
MIRT2613089	hsa-miR-153	CLIP-seq
MIRT2613090	hsa-miR-155	CLIP-seq
MIRT1311735	hsa-miR-199a-3p	CLIP-seq
MIRT1311736	hsa-miR-199b-3p	CLIP-seq
MIRT2317112	hsa-miR-212	CLIP-seq
MIRT2317113	hsa-miR-2682	CLIP-seq
MIRT1311740	hsa-miR-29a	CLIP-seq
MIRT1311741	hsa-miR-29b	CLIP-seq
MIRT1311742	hsa-miR-29c	CLIP-seq
MIRT2317114	hsa-miR-3064-3p	CLIP-seq
MIRT2317115	hsa-miR-3119	CLIP-seq
MIRT1311745	hsa-miR-3129-5p	CLIP-seq
MIRT2092674	hsa-miR-3134	CLIP-seq
MIRT2317116	hsa-miR-3140-3p	CLIP-seq
MIRT1311747	hsa-miR-3158-5p	CLIP-seq
MIRT2613091	hsa-miR-3160-3p	CLIP-seq
MIRT2092675	hsa-miR-3185	CLIP-seq
MIRT2317117	hsa-miR-3187-3p	CLIP-seq
MIRT2613092	hsa-miR-3591-5p	CLIP-seq
MIRT2092676	hsa-miR-3609	CLIP-seq
MIRT1311748	hsa-miR-3613-5p	CLIP-seq
MIRT2613093	hsa-miR-3646	CLIP-seq
MIRT2092677	hsa-miR-3661	CLIP-seq
MIRT2613094	hsa-miR-3662	CLIP-seq
MIRT2613095	hsa-miR-3675-3p	CLIP-seq
MIRT2317121	hsa-miR-3926	CLIP-seq
MIRT1311753	hsa-miR-3973	CLIP-seq
MIRT2613096	hsa-miR-410	CLIP-seq
MIRT2092678	hsa-miR-4255	CLIP-seq
MIRT1311755	hsa-miR-4267	CLIP-seq
MIRT2613097	hsa-miR-4277	CLIP-seq
MIRT1311759	hsa-miR-4310	CLIP-seq
MIRT1311760	hsa-miR-4312	CLIP-seq
MIRT2092679	hsa-miR-4418	CLIP-seq
MIRT2317123	hsa-miR-4435	CLIP-seq
MIRT2317124	hsa-miR-4438	CLIP-seq
MIRT2613098	hsa-miR-4460	CLIP-seq
MIRT2613099	hsa-miR-448	CLIP-seq
MIRT2613100	hsa-miR-4487	CLIP-seq
MIRT2317125	hsa-miR-4490	CLIP-seq
MIRT2317126	hsa-miR-449c	CLIP-seq
MIRT2317127	hsa-miR-4514	CLIP-seq
MIRT2092680	hsa-miR-4534	CLIP-seq
MIRT2092681	hsa-miR-4535	CLIP-seq
MIRT2092682	hsa-miR-4641	CLIP-seq
MIRT2092683	hsa-miR-4668-5p	CLIP-seq
MIRT2317130	hsa-miR-4686	CLIP-seq
MIRT2092684	hsa-miR-4690-3p	CLIP-seq
MIRT2317131	hsa-miR-4692	CLIP-seq
MIRT2613101	hsa-miR-4693-3p	CLIP-seq
MIRT2317132	hsa-miR-4700-3p	CLIP-seq
MIRT2317133	hsa-miR-4701-5p	CLIP-seq
MIRT1311764	hsa-miR-4703-3p	CLIP-seq
MIRT2317134	hsa-miR-4717-3p	CLIP-seq
MIRT2613102	hsa-miR-4727-3p	CLIP-seq
MIRT1311766	hsa-miR-4729	CLIP-seq
MIRT2613103	hsa-miR-4738-3p	CLIP-seq
MIRT2613104	hsa-miR-4753-3p	CLIP-seq
MIRT1311767	hsa-miR-4778-5p	CLIP-seq
MIRT2613105	hsa-miR-4789-5p	CLIP-seq
MIRT1311768	hsa-miR-4797-3p	CLIP-seq
MIRT2613106	hsa-miR-485-3p	CLIP-seq
MIRT2613107	hsa-miR-487a	CLIP-seq
MIRT2317138	hsa-miR-490-3p	CLIP-seq
MIRT2092685	hsa-miR-492	CLIP-seq
MIRT2092686	hsa-miR-509-3-5p	CLIP-seq
MIRT2317139	hsa-miR-5095	CLIP-seq
MIRT2092687	hsa-miR-509-5p	CLIP-seq
MIRT1311770	hsa-miR-520g	CLIP-seq
MIRT1311771	hsa-miR-520h	CLIP-seq
MIRT1311772	hsa-miR-522	CLIP-seq
MIRT1311773	hsa-miR-532-5p	CLIP-seq
MIRT1311774	hsa-miR-544	CLIP-seq
MIRT2092688	hsa-miR-548ah	CLIP-seq
MIRT2317146	hsa-miR-548p	CLIP-seq
MIRT2317147	hsa-miR-548s	CLIP-seq
MIRT2092689	hsa-miR-548t	CLIP-seq
MIRT2317149	hsa-miR-556-5p	CLIP-seq
MIRT2613108	hsa-miR-558	CLIP-seq
MIRT2613109	hsa-miR-562	CLIP-seq
MIRT1311776	hsa-miR-574-3p	CLIP-seq
MIRT2317150	hsa-miR-588	CLIP-seq
MIRT1311779	hsa-miR-628-5p	CLIP-seq
MIRT2092690	hsa-miR-631	CLIP-seq
MIRT1311780	hsa-miR-642b	CLIP-seq
MIRT2317153	hsa-miR-649	CLIP-seq
MIRT2092691	hsa-miR-7	CLIP-seq
MIRT1311781	hsa-miR-767-5p	CLIP-seq
MIRT1311783	hsa-miR-936	CLIP-seq
MIRT2317154	hsa-miR-941	CLIP-seq
MIRT1311784	hsa-miR-944	CLIP-seq
MIRT2317102	hsa-miR-101	CLIP-seq
MIRT1311729	hsa-miR-103a	CLIP-seq
MIRT1311730	hsa-miR-107	CLIP-seq
MIRT1311731	hsa-miR-1178	CLIP-seq
MIRT1311732	hsa-miR-1184	CLIP-seq
MIRT1311733	hsa-miR-1205	CLIP-seq
MIRT2317103	hsa-miR-1207-3p	CLIP-seq
MIRT2092673	hsa-miR-1256	CLIP-seq
MIRT2317106	hsa-miR-132	CLIP-seq
MIRT2317107	hsa-miR-138	CLIP-seq
MIRT2613089	hsa-miR-153	CLIP-seq
MIRT2613090	hsa-miR-155	CLIP-seq
MIRT2317112	hsa-miR-212	CLIP-seq
MIRT2317113	hsa-miR-2682	CLIP-seq
MIRT2317114	hsa-miR-3064-3p	CLIP-seq
MIRT2317115	hsa-miR-3119	CLIP-seq
MIRT2092674	hsa-miR-3134	CLIP-seq
MIRT2317116	hsa-miR-3140-3p	CLIP-seq
MIRT1311747	hsa-miR-3158-5p	CLIP-seq
MIRT2613091	hsa-miR-3160-3p	CLIP-seq
MIRT2092675	hsa-miR-3185	CLIP-seq
MIRT2317117	hsa-miR-3187-3p	CLIP-seq
MIRT2092676	hsa-miR-3609	CLIP-seq
MIRT1311748	hsa-miR-3613-5p	CLIP-seq
MIRT2613093	hsa-miR-3646	CLIP-seq
MIRT2092677	hsa-miR-3661	CLIP-seq
MIRT2613094	hsa-miR-3662	CLIP-seq
MIRT2317121	hsa-miR-3926	CLIP-seq
MIRT1311753	hsa-miR-3973	CLIP-seq
MIRT2613096	hsa-miR-410	CLIP-seq
MIRT2092678	hsa-miR-4255	CLIP-seq
MIRT1311755	hsa-miR-4267	CLIP-seq
MIRT1311759	hsa-miR-4310	CLIP-seq
MIRT1311760	hsa-miR-4312	CLIP-seq
MIRT2092679	hsa-miR-4418	CLIP-seq
MIRT2317123	hsa-miR-4435	CLIP-seq
MIRT2317124	hsa-miR-4438	CLIP-seq
MIRT2613099	hsa-miR-448	CLIP-seq
MIRT2613100	hsa-miR-4487	CLIP-seq
MIRT2317125	hsa-miR-4490	CLIP-seq
MIRT2317126	hsa-miR-449c	CLIP-seq
MIRT2317127	hsa-miR-4514	CLIP-seq
MIRT2092680	hsa-miR-4534	CLIP-seq
MIRT2092681	hsa-miR-4535	CLIP-seq
MIRT2092682	hsa-miR-4641	CLIP-seq
MIRT2092683	hsa-miR-4668-5p	CLIP-seq
MIRT2317130	hsa-miR-4686	CLIP-seq
MIRT2092684	hsa-miR-4690-3p	CLIP-seq
MIRT2317131	hsa-miR-4692	CLIP-seq
MIRT2317132	hsa-miR-4700-3p	CLIP-seq
MIRT2317133	hsa-miR-4701-5p	CLIP-seq
MIRT1311764	hsa-miR-4703-3p	CLIP-seq
MIRT2317134	hsa-miR-4717-3p	CLIP-seq
MIRT1311766	hsa-miR-4729	CLIP-seq
MIRT2613103	hsa-miR-4738-3p	CLIP-seq
MIRT1311767	hsa-miR-4778-5p	CLIP-seq
MIRT2613105	hsa-miR-4789-5p	CLIP-seq
MIRT2613107	hsa-miR-487a	CLIP-seq
MIRT2317138	hsa-miR-490-3p	CLIP-seq
MIRT2092685	hsa-miR-492	CLIP-seq
MIRT2092686	hsa-miR-509-3-5p	CLIP-seq
MIRT2317139	hsa-miR-5095	CLIP-seq
MIRT2092687	hsa-miR-509-5p	CLIP-seq
MIRT1311770	hsa-miR-520g	CLIP-seq
MIRT1311771	hsa-miR-520h	CLIP-seq
MIRT1311772	hsa-miR-522	CLIP-seq
MIRT1311773	hsa-miR-532-5p	CLIP-seq
MIRT1311774	hsa-miR-544	CLIP-seq
MIRT2092688	hsa-miR-548ah	CLIP-seq
MIRT2317146	hsa-miR-548p	CLIP-seq
MIRT2317147	hsa-miR-548s	CLIP-seq
MIRT2092689	hsa-miR-548t	CLIP-seq
MIRT2317149	hsa-miR-556-5p	CLIP-seq
MIRT2613108	hsa-miR-558	CLIP-seq
MIRT2613109	hsa-miR-562	CLIP-seq
MIRT2317150	hsa-miR-588	CLIP-seq
MIRT1311779	hsa-miR-628-5p	CLIP-seq
MIRT2092690	hsa-miR-631	CLIP-seq
MIRT1311780	hsa-miR-642b	CLIP-seq
MIRT2317153	hsa-miR-649	CLIP-seq
MIRT2092691	hsa-miR-7	CLIP-seq
MIRT2317154	hsa-miR-941	CLIP-seq
MIRT1311784	hsa-miR-944	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	TAS	11237715
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	TAS	11237715
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
607119	13432	ENSG00000034677

Q9NV58

Protein name

E3 ubiquitin-protein ligase RNF19A (EC 2.3.2.31) (Double ring-finger protein) (Dorfin) (RING finger protein 19A) (p38)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as SNCAIP or CASR. Specifically ubiquit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01485	IBR	199 → 264	IBR domain, a half RING-finger domain	Domain
PF01485	IBR	283 → 347	IBR domain, a half RING-finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system. {ECO:0000269|PubMed:11237715}.

Sequence

MQEQEIGFISKYNEGLCVNTDPVSILTSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAP
KKRRISIGSLFRRKKDNKRKSRELNGGVDGIASIESIHSEMCTDKNSIFSTNTSSDNGLT
SISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECT
ERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLT
CGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKP
CPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKK
ILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGV
TLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDI
NVGGTNTAVDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGAIRDNLSETASTMA
LAGASITGSLSGSAMVNCFNRLEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSI
LNSYIPLDKEGNSMEVQVDIESKPSKFRHNSGSSSVDDGSATRSHAGGSSSGLPEGKSSA
TKWSKEATAGKKSKSGKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSV
ADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVV
TQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTEI

Sequence length

838

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (28)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (330)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	29298652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29349553, 29484391, 29890468, 30718368, 31432106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11585739, 27775076, 30879017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21164364, 21858220, 22415779, 28900489, 30321617, 30827261, 30879017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15969750, 17078869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28114280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30298517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17950728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28194256		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30233281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30033276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28493082, 29282578, 31429590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	12875980, 15030390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28273913, 29499331, 29789529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28566491, 29366902, 31378753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	25270909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31447579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31456484		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25426613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31398429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30905780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28437005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16043718, 18026701, 22488549, 24107108, 28343998, 29206314		★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28948356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	14991070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18314537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	31014201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12641490, 26517722, 28402030, 29284473, 29448086, 29554934, 30186353, 30428724, 30511684, 30589094, 31445014, 31602218, 31808595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	30244166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12191496, 17446059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30297392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23139385, 23190644, 24741615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28493082, 29282578, 31429590		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15753397, 21092277, 24738081, 28158919, 28272166, 28713946, 28849038, 29725459, 30106096, 30106128, 30335886, 30368882, 30426692, 30944654		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15483673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31464618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	31789406		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	31789406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31078518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19293182, 21902544, 22154358, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22425892, 29637005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29382550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	18058803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10766865, 12698197, 12972603, 15056732, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986, 22157753, 22579953 View all (27 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	34789768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	22585574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34184814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19293182, 21902544, 22154358, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17609948, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26872057, 27026405, 27537399, 27922667, 28460458, 30280780, 30827261, 31428903, 31489665, 31695416 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22302101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27322208, 30049957, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	29506687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30292134, 31494123, 31689891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	BEFREE	19246713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30503674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29382550		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12717393, 16469407, 23024367, 25502636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16639284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16549373, 18340449, 21328612, 26168133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	16279571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27226108, 30897126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15483673, 16408101, 18288129, 26337206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28237966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17406066, 28214201, 28621371, 29074542, 29566026, 29719383, 30588579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	19946178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29467361, 30609815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16838116, 25533544, 31205031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15037631, 16849586, 21847367, 22076613, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25890501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10769637, 15975962, 20413844, 23900560, 28376477, 28731192, 28864417, 30211553, 30221676, 30588113, 30864690, 30949407, 31650548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28049487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 28100897, 28104751, 30860934, 31505169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20307495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29122645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22585574, 30804419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450, 25533544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20460375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18031579, 18223264, 18523305, 20155832, 21181091, 25091567, 26873249, 27907835, 28337303, 28744712, 29061447, 29524442, 29682561, 29899528, 31210280, 31308631, 31760158, 31831024 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24455679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21810259, 29867510, 31629950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29535261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28493082, 29282578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25912722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21288594, 29621941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	29088769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12957654, 17554073, 28534138, 31794124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12957654, 17554073, 21478266, 28534138, 28807219, 29523003, 29615288, 31794124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17922475, 21892182, 25758573, 28888936, 29663930, 30284474, 30981822, 31072439, 31473185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30067872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27226108, 28588674, 28672912, 30049003, 30784180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22605924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30446590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	29721975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	30119655		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26033187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25912722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	26153023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15550066, 24923883, 26394174, 28845752, 30773096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	20885979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16792588		★★★★★ ★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	19801633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28472735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28188686, 30868916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30049957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25502636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28493083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22234699		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22234699		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	28539126		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP F	Fanconi Anemia	BEFREE	22952942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30205811, 30914267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	16753021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29104242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29705706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23459070, 29322133, 30700848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28483380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	29568068		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29568068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	29217619, 31751591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	26312487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	26312487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22528800, 22901381, 23261467, 24185179, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22528800, 22901381, 23261467, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309, 31143512, 31295040, 31673920, 31719901 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17406030, 22114076, 27609291, 28012022, 28569417, 29316898, 30674294, 30678338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28483380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31548323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	31548323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	23837874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22110204, 29983416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 28104751, 31505169		★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	25583406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	31130074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	16786433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26660341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18327563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12107734, 12957654, 24720336, 25758573, 26439801, 28731135, 28962618, 29421811, 31150695, 9916130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30651770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	28185107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	14561851, 27283322, 29566148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	28471037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28910144, 30274147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30074215		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30897126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30302660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27283322, 28472735, 29201176, 29467361, 29804103, 30609815, 30695686, 30845718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	28601021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16838116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29535261, 31378305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	20661932, 26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26911458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28241849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28500782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29663930, 31115561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31810142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	18221537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27226108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28881633, 29504713, 30511081, 30539653, 30976980, 30991714, 31639165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28352125		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15514005, 23707387, 23880928, 25684043, 26205966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20543580, 25426669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17950728		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	22243975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10445852, 15849811, 17673262, 19497411, 21102517, 21732638, 23029478, 23319057, 24199952, 25230705, 25514221, 25703929, 25874498, 27662474, 28190473 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10445852, 21732638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12584565, 27226640, 28007785, 30867890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27365897, 30145800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30268079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	18094073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16247482, 22649101, 23153195, 29604597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15077178, 26475474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	18362077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	22243975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23261452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22110204, 29983416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12698197, 12972603, 15056732, 16897432, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986, 22157753, 22825349 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23722928, 29344159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31147803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17609948, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26872057, 27026405, 27537399, 27922667, 28007785, 28460458, 30280780, 30827261, 31489665, 31695416 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27322208, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15031672, 16437387, 16618780, 16956884, 18413810, 22493721, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961, 29416632, 29894706, 30250582, 31509289 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12370831, 30468479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27890795, 29237470, 30011079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19293182, 21902544, 22154358, 29463565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17483345, 18217689, 19852565, 21470196, 21885439, 22106296, 22154358, 22302101, 22522455, 23335506, 23403951, 24030148, 24115572, 24356814, 24366869 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23940799, 30098789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15037631, 16849586, 21847367, 22076613, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19920204, 21099351, 24251561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27893734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10871852, 15378016, 18068334, 18983537, 29067466, 29276966, 29291012, 30873870, 31401046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29867510, 31629950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	16279571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18593922, 19282458, 22425892, 23066034, 30583070, 31777580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21791428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29723037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31189728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16272363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	16204077		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16204077, 16940419, 22327869, 25480830, 28405919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29670085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17949234, 19324082, 19672773, 21890458, 28133573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28237966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28559372, 28713990, 29232411, 29434760, 29630131, 29991775, 30116330, 30391964, 31646600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	20307495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	31370111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23406595, 30804419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20607722, 31436393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11279018, 12021785, 12972603, 14730602, 15492254, 1560527, 15611662, 15976377, 16230412, 17108114, 17254968, 17346218, 18245484, 19584293, 19740433 View all (50 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29187369		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30983972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11032891, 11163539, 11598801, 15784962, 15950779, 16484283, 18534018, 19009558, 23507189, 25033461, 25086905, 25148040, 28831692, 30545920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30327995, 30735722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28202578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30908654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10874022, 16705311, 21306997, 22053010, 23456625, 24026034, 24292713, 26503828, 26799187, 28286419, 28460458, 29110442, 30564960, 30605882, 30771292 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29575791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24929539, 25034973, 29317435, 31139234, 31553232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30731111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19828631, 28343998, 30439432, 30934850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30934850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19330880, 22849560, 23262982, 26238193, 27799356, 28350136, 29434992, 29607921, 30267330, 30746754, 31268160, 31505816, 31719210		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27322208, 31301414		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25655200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	31432106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25231838, 25592304, 30904818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	12750386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12783850, 16049031, 21209210, 28035410, 28365714, 29540778, 29899409, 30071902, 30933849, 30995872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	28928733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	23657501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	31586635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	26138525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28120492, 29207066, 31599069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31387001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31387001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	15698454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	19946178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29168690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31231308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28344879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26010611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28295194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26010611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15031672, 16618780, 16956884, 18413810, 19242540, 22493721, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961, 29416632, 29894706, 30250582, 31509289 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22493721	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36623445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24863062, 28266627, 28602508, 31378305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	29049722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27226108, 30082522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23859041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22076433, 26919280, 27365897, 29661023, 30127380, 30897126, 31739543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28948356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	12819782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12819782, 29039541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	12819782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restrictive cardiomyopathy	Restrictive cardiomyopathy	BEFREE	11593045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29408550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31648555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602, 27642049, 29109039, 29237430, 29790698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12186945, 29790086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12641490, 14730602, 15170913, 15557189, 16778989, 16947383, 17530707, 19765281, 19828631, 22488549, 24574214, 25367151, 25932604, 26420479, 27226108 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	28657795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22243975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28035416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11918720, 16098034		★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30954890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	BEFREE	23401567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15658002, 15977985, 29201176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28147298, 29039541, 29227823, 31775794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	17470913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31585897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31309463		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	31078518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	28887603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23656793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20121928, 31315217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22167332, 22522455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28469797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20717005, 22110204, 24568968, 27531877, 28915597, 29575240, 29747487, 30622052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29410394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31331032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30914267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28949055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27890795, 29237470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29160895, 30242669, 30980845		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19737974		★★★★★ ★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	25429073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11918720, 16098034, 28189565, 30404019		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	28194179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	12581337, 15658002, 15977985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31547619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25045295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28194179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29777109, 29880481, 30462562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30928642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26090671, 28667430, 29518435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39508245	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	23401649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30158835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19207217		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19207217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30173943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	16803993, 20536832		★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	30555679		★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF19A (ring finger protein 19A, RBR E3 ubiquitin protein ligase)