Gene Gene information from NCBI Gene database.
Entrez ID 25893
Gene name Tripartite motif containing 58
Gene symbol TRIM58
Synonyms (NCBI Gene)
BIA2
Chromosome 1
Chromosome location 1q44
miRNA miRNA information provided by mirtarbase database.
345
miRTarBase ID miRNA Experiments Reference
MIRT029012 hsa-miR-26b-5p Microarray 19088304
MIRT516609 hsa-miR-4438 HITS-CLIP 23313552
MIRT693320 hsa-miR-1295b-5p HITS-CLIP 23313552
MIRT693319 hsa-miR-1912 HITS-CLIP 23313552
MIRT693318 hsa-miR-3130-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0005737 Component Cytoplasm IBA
GO:0006511 Process Ubiquitin-dependent protein catabolic process IEA
GO:0008270 Function Zinc ion binding IEA
GO:0010468 Process Regulation of gene expression IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620527 24150 ENSG00000162722
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NG06
Protein name E3 ubiquitin-protein ligase TRIM58 (EC 2.3.2.27) (Protein BIA2) (RING-type E3 ubiquitin transferase TRIM58) (Tripartite motif-containing protein 58)
Protein function E3 ubiquitin ligase induced during late erythropoiesis. Directly binds and ubiquitinates the intermediate chain of the microtubule motor dynein (DYNC1LI1/DYNC1LI2), stimulating the degradation of the dynein holoprotein complex. May participate i
PDB 8PD4 , 8PD6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 16 60 Domain
PF00643 zf-B_box 91 132 B-box zinc finger Domain
PF13765 PRY 293 341 SPRY-associated domain Family
PF00622 SPRY 345 454 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in erythroblasts. {ECO:0000269|PubMed:25241935}.
Sequence
MAWAPPGERLREDARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDGAQGGVYACPQC
RGPFRPSGFRPNRQLAGLVESVRRLGLGAGPGARRCARHGEDLSRFCEEDEAALCWVCDA
GPEHRTHRTAPL
QEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKEKVEMQRQ
RFRLEFEKHRGFLAQEEQRQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERC
QRPALGLLEGVRGVLSRSKAVTRLEAENIPMELKTACCIPGRRELLRKFQVDVKLDPATA
HPSLLLTADLRSVQDGEPWRDVPNNPERFDTWPCILGLQSF
SSGRHYWEVLVGEGAEWGL
GVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAG
EISFYNVTDGSYIYTFNQLFSGLLRPYFFICDAT
PLILPPTTIAGSGNWASRDHLDPASD
VRDDHL
Sequence length 486
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MYELOPROLIFERATIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 27926516
★☆☆☆☆
Found in Text Mining only
Arthritis Juvenile Juvenile arthritis Pubtator 34435051 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 29749538, 29956813
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 29749538, 32218699 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 29956813
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 29956813 Inhibit
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37158531 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 27373520
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 26842235, 29749538, 29956813 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 29749538, 29956813
★☆☆☆☆
Found in Text Mining only