Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	25891
Gene name	Peptidase domain containing associated with muscle regeneration 1
Gene symbol	PAMR1
Synonyms (NCBI Gene)	DKFZP586H2123FP938RAMP
Chromosome	11
Chromosome location	11p13

Show/Hide all (69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038765	hsa-miR-93-3p	CLASH	23622248
MIRT1211985	hsa-miR-1252	CLIP-seq
MIRT1211986	hsa-miR-1273f	CLIP-seq
MIRT1211987	hsa-miR-2110	CLIP-seq
MIRT1211988	hsa-miR-4271	CLIP-seq
MIRT1211989	hsa-miR-4533	CLIP-seq
MIRT1211990	hsa-miR-4725-3p	CLIP-seq
MIRT1211991	hsa-miR-4747-5p	CLIP-seq
MIRT2587319	hsa-miR-122	CLIP-seq
MIRT2587320	hsa-miR-125a-5p	CLIP-seq
MIRT2587321	hsa-miR-125b	CLIP-seq
MIRT2587322	hsa-miR-185	CLIP-seq
MIRT1211987	hsa-miR-2110	CLIP-seq
MIRT2587323	hsa-miR-2355-3p	CLIP-seq
MIRT2587324	hsa-miR-3149	CLIP-seq
MIRT2587325	hsa-miR-3150a-3p	CLIP-seq
MIRT2587326	hsa-miR-3185	CLIP-seq
MIRT2587327	hsa-miR-3620	CLIP-seq
MIRT2587328	hsa-miR-4259	CLIP-seq
MIRT1211988	hsa-miR-4271	CLIP-seq
MIRT2587329	hsa-miR-4306	CLIP-seq
MIRT2587330	hsa-miR-4319	CLIP-seq
MIRT2587331	hsa-miR-4420	CLIP-seq
MIRT2587332	hsa-miR-4644	CLIP-seq
MIRT2587333	hsa-miR-4646-3p	CLIP-seq
MIRT2587334	hsa-miR-4682	CLIP-seq
MIRT2587335	hsa-miR-4697-3p	CLIP-seq
MIRT2587336	hsa-miR-4709-3p	CLIP-seq
MIRT1211990	hsa-miR-4725-3p	CLIP-seq
MIRT2587337	hsa-miR-4732-3p	CLIP-seq
MIRT2587338	hsa-miR-4733-3p	CLIP-seq
MIRT2587339	hsa-miR-4778-3p	CLIP-seq
MIRT2587340	hsa-miR-513c	CLIP-seq
MIRT2587341	hsa-miR-514b-5p	CLIP-seq
MIRT2587342	hsa-miR-568	CLIP-seq
MIRT2587343	hsa-miR-642b	CLIP-seq
MIRT2587344	hsa-miR-670	CLIP-seq
MIRT2587345	hsa-miR-7	CLIP-seq
MIRT2587319	hsa-miR-122	CLIP-seq
MIRT2587320	hsa-miR-125a-5p	CLIP-seq
MIRT2587321	hsa-miR-125b	CLIP-seq
MIRT2587322	hsa-miR-185	CLIP-seq
MIRT1211987	hsa-miR-2110	CLIP-seq
MIRT2587323	hsa-miR-2355-3p	CLIP-seq
MIRT2587324	hsa-miR-3149	CLIP-seq
MIRT2587325	hsa-miR-3150a-3p	CLIP-seq
MIRT2587326	hsa-miR-3185	CLIP-seq
MIRT2587327	hsa-miR-3620	CLIP-seq
MIRT2687052	hsa-miR-371b-5p	CLIP-seq
MIRT2587328	hsa-miR-4259	CLIP-seq
MIRT1211988	hsa-miR-4271	CLIP-seq
MIRT2587329	hsa-miR-4306	CLIP-seq
MIRT2587330	hsa-miR-4319	CLIP-seq
MIRT2587331	hsa-miR-4420	CLIP-seq
MIRT2587332	hsa-miR-4644	CLIP-seq
MIRT2587333	hsa-miR-4646-3p	CLIP-seq
MIRT2587334	hsa-miR-4682	CLIP-seq
MIRT2587335	hsa-miR-4697-3p	CLIP-seq
MIRT2587336	hsa-miR-4709-3p	CLIP-seq
MIRT1211990	hsa-miR-4725-3p	CLIP-seq
MIRT2587337	hsa-miR-4732-3p	CLIP-seq
MIRT2587338	hsa-miR-4733-3p	CLIP-seq
MIRT2587339	hsa-miR-4778-3p	CLIP-seq
MIRT2587340	hsa-miR-513c	CLIP-seq
MIRT2587341	hsa-miR-514b-5p	CLIP-seq
MIRT2587342	hsa-miR-568	CLIP-seq
MIRT2587343	hsa-miR-642b	CLIP-seq
MIRT2587344	hsa-miR-670	CLIP-seq
MIRT2587345	hsa-miR-7	CLIP-seq

Show/Hide all (2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UXH9

Protein name

Inactive serine protease PAMR1 (Peptidase domain-containing protein associated with muscle regeneration 1) (Regeneration-associated muscle protease homolog)

Protein function

May play a role in regeneration of skeletal muscle.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00431	CUB	128 → 233	CUB domain	Domain
PF00008	EGF	239 → 270	EGF-like domain	Domain
PF00084	Sushi	280 → 342	Sushi repeat (SCR repeat)	Domain
PF00084	Sushi	389 → 442	Sushi repeat (SCR repeat)	Domain
PF00089	Trypsin	452 → 715	Trypsin	Domain

Sequence

MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKRE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGFVIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSIGSSLHVLFHSDGSKNFDGFHAIYEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEERNCSDPGGPVNGYQKITGGPGLI
NGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIKACREPKISDLVRRRVL
PMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPMGYQHLHTQLQYECISPFYR
RLGSSRRTCLRTGKWSGRAPSCIPICGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSL
HKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQS
LQISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAASRDLSTSFQESHITVAG
WNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSVTDNMFCASWEPTAPSDI
CTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLSTAFTKVLPFKDWIERNMK

Sequence length

720

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	25010197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25370079, 28410206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	24037755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29246949, 30155847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29246949, 30155847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34337010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	15619030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25370079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15111323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	LHGDN	15111323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	9499416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25370079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34922489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PAMR1 (peptidase domain containing associated with muscle regeneration 1)