Gene Gene information from NCBI Gene database.
Entrez ID 25886
Gene name POC1 centriolar protein A
Gene symbol POC1A
Synonyms (NCBI Gene)
PIX2SOFTWDR51A
Chromosome 3
Chromosome location 3p21.2
Summary POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in th
SNPs SNP information provided by dbSNP.
6
SNP ID Visualize variation Clinical significance Consequence
rs112213336 C>G Likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs397514487 G>A Likely-pathogenic, pathogenic Non coding transcript variant, coding sequence variant, stop gained
rs397514488 A>G Pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs772586602 AG>- Pathogenic Non coding transcript variant, coding sequence variant, intron variant, frameshift variant
rs866964603 C>T Likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT724035 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT724034 hsa-miR-874-5p HITS-CLIP 19536157
MIRT724033 hsa-miR-663b HITS-CLIP 19536157
MIRT724032 hsa-miR-7108-5p HITS-CLIP 19536157
MIRT666923 hsa-miR-5571-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IDA 23015594
GO:0000922 Component Spindle pole IEA
GO:0003431 Process Growth plate cartilage chondrocyte development IEA
GO:0005515 Function Protein binding IPI 23015594, 25036637, 26638075, 28514442, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614783 24488 ENSG00000164087
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NBT0
Protein name POC1 centriolar protein homolog A (Pix2) (Proteome of centriole protein 1A) (WD repeat-containing protein 51A)
Protein function Plays an important role in centriole assembly and/or stability and ciliogenesis. Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Acts in concert with POC1B to ensure centriole integrit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 9 47 WD domain, G-beta repeat Repeat
PF00400 WD40 51 89 WD domain, G-beta repeat Repeat
PF00400 WD40 94 130 WD domain, G-beta repeat Repeat
PF00400 WD40 135 173 WD domain, G-beta repeat Repeat
PF00400 WD40 177 215 WD domain, G-beta repeat Repeat
PF00400 WD40 261 299 WD domain, G-beta repeat Repeat
Sequence
MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGH
KDAVTCVNFSPSGHLLASGSRDKTVRIWV
PNVKGESTVFRAHTATVRSVHFCSDGQSFVT
ASDDKTVKVW
ATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECV
HSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWD
VRTHRLLQHYQLHSAAVNGLSFHPS
GNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMVWKS
NFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQEPVSVPQTLT
STLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP
Sequence length 407
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Ateleiotic dwarfism Pathogenic rs397514487 RCV001838528
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cervical cancer Likely pathogenic rs146848374 RCV005928360
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
POC1A-related disorder Likely pathogenic rs2107090748 RCV003403757
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
POC1A-related syndrome Pathogenic rs1703818635, rs763709592 RCV001260581
RCV001260582
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Brachydactyly Brachydactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 24074788, 30261866
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 33725402 Associate
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathies BEFREE 22840364
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathy Pubtator 22840364 Associate
★☆☆☆☆
Found in Text Mining only
Class III malocclusion Malocclusion HPO_DG
★☆☆☆☆
Found in Text Mining only
Clinodactyly Clinodactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
Clinodactyly of fingers Clinodactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital Abnormalities Congenital abnormalities Pubtator 22840364 Associate
★☆☆☆☆
Found in Text Mining only
Congenital chromosomal disease Congenital Chromosomal Disease BEFREE 25385269
★☆☆☆☆
Found in Text Mining only