GALR1 (galanin receptor 1)

Gene

• Entrez ID: 2587
• Gene name: Galanin receptor 1
• Gene symbol: GALR1
• Synonyms (NCBI Gene): GALNR, GALNR1
• Chromosome: 18
• Chromosome location: 18q23
• Summary: The neuropeptide galanin elicits a range of biological effects by interaction with specific G-protein-coupled receptors. Galanin receptors are seven-transmembrane proteins shown to activate a variety of intracellular second-messenger pathways. GALR1 inh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT718909	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT718908	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT718907	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT718906	hsa-miR-411-5p	HITS-CLIP	19536157
MIRT718905	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT718904	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT718903	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT718902	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT718909	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT718908	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT718907	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT718906	hsa-miR-411-5p	HITS-CLIP	19536157
MIRT718905	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT718904	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT718903	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT718902	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT1011690	hsa-miR-1226	CLIP-seq
MIRT1011691	hsa-miR-1915	CLIP-seq
MIRT1011692	hsa-miR-204	CLIP-seq
MIRT1011693	hsa-miR-211	CLIP-seq
MIRT1011694	hsa-miR-217	CLIP-seq
MIRT1011695	hsa-miR-3125	CLIP-seq
MIRT1011696	hsa-miR-324-5p	CLIP-seq
MIRT1011697	hsa-miR-3916	CLIP-seq
MIRT1011698	hsa-miR-4418	CLIP-seq
MIRT1011699	hsa-miR-4709-3p	CLIP-seq
MIRT1011700	hsa-miR-4712-5p	CLIP-seq
MIRT1011701	hsa-miR-4726-3p	CLIP-seq
MIRT1011702	hsa-miR-4733-3p	CLIP-seq
MIRT1011703	hsa-miR-4755-5p	CLIP-seq
MIRT1011704	hsa-miR-509-3-5p	CLIP-seq
MIRT1011705	hsa-miR-509-5p	CLIP-seq
MIRT1011706	hsa-miR-623	CLIP-seq
MIRT1011707	hsa-miR-654-3p	CLIP-seq
MIRT1011708	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0004966	Function	Galanin receptor activity	IDA	24517231
GO:0004966	Function	Galanin receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	TAS	7524088
GO:0005515	Function	Protein binding	IPI	23597562, 25691535, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7524088
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	7524088
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	7524088
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7524088
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0042923	Function	Neuropeptide binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0051464	Process	Positive regulation of cortisol secretion	IMP	17982695

Other IDs

• MIM: 600377
• HGNC: 4132
• e!Ensembl: ENSG00000166573

Protein

• UniProt ID: P47211
• Protein name: Galanin receptor type 1 (GAL1-R) (GALR-1)
• Protein function: Receptor for the hormone galanin. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.
• PDB: 7WQ3, 7XJJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	50 → 303	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
  SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
  VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
  ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
  SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
  IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV

• Sequence length: 349

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALR1-related disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety disorder	Pubtator	24706871	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28013000		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	37443714	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30551408		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22859720		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22859720, 35409094	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36551197	Stimulate	★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	30487761		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24706871	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28013000		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23727823		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23727823	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28013000		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12734662		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31537867, 32265844	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19047085, 26572146, 27685843		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19047085, 27685843	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	23727823	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28098336		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	27940914		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	27940914		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29462183		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	27940914		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19047085, 26572146, 27685843		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23727823		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29462183		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23727823		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28013000		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29462183	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12734662, 19047085, 19276245, 22889491, 23018873, 24122450, 25017118, 26572146, 27685843, 29462183		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11857022	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29127424		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31843573		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15930442		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	15930442	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	27685843		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521	Associate	★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30487761		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	27940914		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18973137		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19047085		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19047085, 29462183	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24168112, 27027429, 27685843	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19047085, 24168112, 25017118, 26572146, 27027429, 27685843, 29462183		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26769141	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33150179	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26504828	Associate	★☆☆☆☆ Found in Text Mining only