PRKD2 (protein kinase D2)

Gene

• Entrez ID: 25865
• Gene name: Protein kinase D2
• Gene symbol: PRKD2
• Synonyms (NCBI Gene): HSPC187, PKD2, nPKC-D2
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004187	hsa-miR-197-3p	Microarray	16822819
MIRT639968	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639967	hsa-miR-4438	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639966	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT639965	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT639964	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639963	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT639962	hsa-miR-4775	HITS-CLIP	23824327
MIRT639961	hsa-miR-5095	HITS-CLIP	23824327
MIRT639960	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639958	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT639957	hsa-miR-3149	HITS-CLIP	23824327
MIRT525119	hsa-miR-3654	PAR-CLIP	22012620
MIRT525118	hsa-miR-3690	PAR-CLIP	22012620
MIRT525117	hsa-miR-4254	PAR-CLIP	22012620
MIRT525116	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525115	hsa-miR-378b	PAR-CLIP	22012620
MIRT525114	hsa-miR-378c	PAR-CLIP	22012620
MIRT525113	hsa-miR-378d	PAR-CLIP	22012620
MIRT525112	hsa-miR-378e	PAR-CLIP	22012620
MIRT525111	hsa-miR-378f	PAR-CLIP	22012620
MIRT525109	hsa-miR-378h	PAR-CLIP	22012620
MIRT525110	hsa-miR-378i	PAR-CLIP	22012620
MIRT525108	hsa-miR-422a	PAR-CLIP	22012620
MIRT525107	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT525106	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT525105	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT639968	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT639967	hsa-miR-4438	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639966	hsa-miR-455-5p	HITS-CLIP	23824327
MIRT639965	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT639964	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT639963	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT639962	hsa-miR-4775	HITS-CLIP	23824327
MIRT639961	hsa-miR-5095	HITS-CLIP	23824327
MIRT639960	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT639959	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT639958	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT639957	hsa-miR-3149	HITS-CLIP	23824327
MIRT525119	hsa-miR-3654	PAR-CLIP	22012620
MIRT525118	hsa-miR-3690	PAR-CLIP	22012620
MIRT525117	hsa-miR-4254	PAR-CLIP	22012620
MIRT525116	hsa-miR-378a-3p	PAR-CLIP	22012620
MIRT525115	hsa-miR-378b	PAR-CLIP	22012620
MIRT525114	hsa-miR-378c	PAR-CLIP	22012620
MIRT525113	hsa-miR-378d	PAR-CLIP	22012620
MIRT525112	hsa-miR-378e	PAR-CLIP	22012620
MIRT525111	hsa-miR-378f	PAR-CLIP	22012620
MIRT525109	hsa-miR-378h	PAR-CLIP	22012620
MIRT525110	hsa-miR-378i	PAR-CLIP	22012620
MIRT525108	hsa-miR-422a	PAR-CLIP	22012620
MIRT525107	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT525106	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT525105	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT2304097	hsa-miR-4446-5p	CLIP-seq
MIRT2304098	hsa-miR-4755-5p	CLIP-seq
MIRT2304099	hsa-miR-4786-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IGI	20497126
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19001381
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IDA	17077180
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18440775
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	28428613
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	11062248
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS
GO:0005080	Function	Protein kinase C binding	IPI	28428613
GO:0005515	Function	Protein binding	IPI	17962809, 19192391, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17077180
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	17077180
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	22228765
GO:0006468	Process	Protein phosphorylation	NAS	11062248
GO:0007155	Process	Cell adhesion	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	19001381
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	IEA
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IMP	19001381
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16928771
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IMP	18059339, 18440775
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IGI	20497126
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IMP	18059339, 18440775
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	20497126
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	18440775
GO:0045743	Process	Positive regulation of fibroblast growth factor receptor signaling pathway	IMP	19001381
GO:0045766	Process	Positive regulation of angiogenesis	IGI	20497126
GO:0045766	Process	Positive regulation of angiogenesis	IMP	18440775, 19001381
GO:0045785	Process	Positive regulation of cell adhesion	IMP	17951978
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17077180
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	20497126
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18059339
GO:0046872	Function	Metal ion binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IGI	20497126
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	18059339, 18440775
GO:0050852	Process	T cell receptor signaling pathway	IDA	17077180
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	ISS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	19192391
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	15604256, 16928771
GO:0061154	Process	Endothelial tube morphogenesis	TAS	21488147
GO:0070232	Process	Regulation of T cell apoptotic process	IMP	17077180
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IGI	20497126
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA
GO:2000573	Process	Positive regulation of DNA biosynthetic process	ISS
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IGI	20497126
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IMP	18440775

Other IDs

• MIM: 607074
• HGNC: 17293
• e!Ensembl: ENSG00000105287

Protein

• UniProt ID: Q9BZL6
• Protein name: Serine/threonine-protein kinase D2 (EC 2.7.11.13) (nPKC-D2)
• Protein function: Serine/threonine-protein kinase that converts transient diacylglycerol (DAG) signals into prolonged physiological effects downstream of PKC, and is involved in the regulation of cell proliferation via MAPK1/3 (ERK1/2) signaling, oxidative stress
• PDB: 2COA, 3BGM, 4NNX, 4NNY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00130	C1_1	139 → 191	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00130	C1_1	265 → 317	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00069	Pkinase	552 → 807	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11062248}.
• Sequence:

  MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
  PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
  VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
  AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
  SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
  NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
  ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
  LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
  MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
  ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
  ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
  ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
  EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
  IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
  AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

• Sequence length: 878

Pathways

KEGG:

Rap1 signaling pathway
Aldosterone synthesis and secretion
Chemical carcinogenesis - reactive oxygen species

Reactome:

Sphingolipid de novo biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKD2-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31849496		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26426580		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30718593		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31206208		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	22217803		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32967721	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	36857877	Stimulate	★☆☆☆☆ Found in Text Mining only
Angiolipoma	Angiolipoma	BEFREE	28139834		★☆☆☆☆ Found in Text Mining only
Angiopathy, Hereditary, With Nephropathy, Aneurysms, And Muscle Cramps	Angiopathy, Hereditary, With Nephropathy, Aneurysms, And Muscle Cramps	BEFREE	29395486		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	24847910	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	39895541	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	29378535	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 21768215, 23263486		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	27899376, 30899057		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19520973, 26286632	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28839241		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28839241	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	23376035		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	32967721	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31540692		★☆☆☆☆ Found in Text Mining only
Autosomal dominant polycystic kidney disease	Polycystic kidney disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	10200981, 11981261, 18256315, 22034641, 30566001, 31427367, 8005596		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29071385		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	23001835	Associate	★☆☆☆☆ Found in Text Mining only
Blood Protein Disorders	Blood protein disorder	Pubtator	26381842	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29259300, 30652415		★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	16899224	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	26336132	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29071385		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18416462	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32384474	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	18754774, 29271023		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	18754774	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	35370030	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35370030	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	31541223		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31059014		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36231050	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	23603763, 27992413		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	17699277		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11007674, 12707387, 14993477, 17100995, 20807608, 21071968, 21277361, 23496908, 29395486, 29606500, 29973168, 31515477, 31740684, 7666395		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	12411744, 17699277, 26718059		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18758461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	18758461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	18758461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	18758461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ciliopathies	Ciliopathy	Pubtator	30042192	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25123959		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31059014		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	17084592		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21156805, 23376035		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	35285136	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	10655555, 10835625, 11195048, 11252306, 12411744, 16430766, 17292589, 27552964, 30651829, 30858458		★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	10469838, 17292589, 24235270		★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	17292589		★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	LHGDN	17292589		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	28100911	Associate	★☆☆☆☆ Found in Text Mining only
Denys-Drash Syndrome	Denys-Drash Syndrome	BEFREE	24379226		★☆☆☆☆ Found in Text Mining only
Dextrocardia	Dextrocardia	BEFREE	21719175		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22403184	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	19430480, 25751624		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	19430480		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29378535		★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium Syndrome	BEFREE	19801576		★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	30566001	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21805241	Associate	★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	12480558, 15226261, 15482771, 17346947, 20075061, 20938930, 21490950, 24011172, 27730436, 28578020, 28679762, 29042084, 30566001, 30927425, 31079206, 31251475, 31830556		★☆☆☆☆ Found in Text Mining only
Familial paroxysmal dystonia	Paroxysmal dystonia	Pubtator	24009235, 24374109, 24694054, 26139440, 28522688, 30333007, 33305291, 36773205, 37962562	Associate	★☆☆☆☆ Found in Text Mining only
Familial thoracic aortic aneurysm and aortic dissection	Thoracic Aortic Aneurysm And Aortic Dissection	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	17346947		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	37616163	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21727210, 23562655		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23562655, 34234410	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21727210, 23562655		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21727210, 25218347, 29259300		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 21768215, 23263486		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	26909964, 32000861	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	27899376, 30899057		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	31514750	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	30675260		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33274210	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21156805, 23376035		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	28356211	Associate	★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	12954713		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	29057897		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29789568		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28356211	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17699277, 19265036, 26150605, 28992127, 30511640, 31541223, 8915974		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	30197413, 32000861	Associate	★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 1, Intestinal	Intestinal Hypomagnesemia	BEFREE	17346947		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25000413		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25000413	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	11134244, 12842373, 27567292, 28800037, 8749697		★☆☆☆☆ Found in Text Mining only
Isolated polycystic liver disease	Polycystic liver disease	BEFREE	24506938		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11156533, 12707387, 26453610, 26823553, 29395486, 30042192, 31395617, 31488014, 34716216, 34962918, 35099770, 36833371, 36890159, 37509056, 9878261	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12707387, 12832751, 15709698, 15717641, 16720597, 21894000, 27165007, 29518398, 29633426, 30105413, 31767049, 31805375, 8749697, 9878261		★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	34962918, 36573973	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12707387, 26718155		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10411676, 12707387, 23431072, 23496908, 26453610, 28356211, 31514750, 31740684, 36422197, 38537868, 7666395	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	11007674, 12707387, 14993477, 17100995, 20807608, 21071968, 21277361, 23496908, 29395486, 29606500, 29973168, 31515477, 31740684, 7666395		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27832627, 30675260		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29259300		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	26241492	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31849496		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26683365		★☆☆☆☆ Found in Text Mining only
Liver cyst	Liver Cyst	BEFREE	10405208, 15382167, 18199703, 20388629, 27826057		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	16430766, 26823553	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30718593	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30718593	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20220060	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	30675260		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29259300, 30652415, 30845378		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	20732914		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22797919, 30841931		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29071385		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22734003, 27832627, 29259300, 31059014, 31251475		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	36877184	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29789568		★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	16133264		★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	11007674, 11095651, 12707387, 17429049, 22383692, 23376035, 24925719, 26275819, 26364947, 9856513, 9856528		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	15604256		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26072332		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32767326	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26241492	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12527301, 20732914, 21744088, 22204817, 23503467, 24336522, 29259300, 30843621, 31059014		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	18262756		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37579195	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	37579195	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30665572		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32180586	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	26435415, 27046073		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	27046073	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	27046073		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18416462, 24336522, 24847910	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22403184	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	22217803		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	10097141, 10207066, 10411676, 10417277, 10497221, 11156533, 11786542, 11967008, 11991947, 12707387, 12734101, 14718571, 15692563, 16278216, 16430766, 17090781, 18077784, 18256307, 18754774, 18755075, 18818683, 19158373, 19193631, 19443633, 19546223, 1980516, 20169078, 20335443, 20439752, 20558538, 21474446, 21622852, 22008521, 22034641, 22169896, 22185115, 22383692, 22608885, 23431072, 23496908, 23760289, 24374109, 24487363, 24658975, 24694054, 24821069, 24842140, 25029430, 25180832, 25475747, 25491204, 25531466, 25920554, 26077033, 26139440, 26381842, 26453610, 26632257, 26823553, 27046073, 27165007, 27259053, 27499327, 27552964, 27782177, 27835667, 27871310, 28154010, 28356211, 28522688, 29055226, 29378535, 29395486, 29529603, 29590654, 29973168, 29986647, 30042192, 30135240, 30333007, 30369598, 30566001, 30639418, 30665565, 30858458, 30895336, 31056860, 31186083, 31341901, 31395617, 31488014, 31514750, 31556469, 31830647, 31870441, 31874800, 32332171, 32384474, 32398770, 32533764, 32747355, 32784291, 32957937, 33305291, 33437033, 33639313, 33799277, 34515037, 34716216, 34962918, 35313307, 35627274, 35896117, 36029107, 36291168, 36299464, 36422197, 36573973, 36773205, 36833371, 37231942, 37268502, 37272738, 37468838, 37628640, 37723847, 37750370, 37761895, 37909612, 38483987, 38537868, 39714991, 40428294, 7825585, 9326320, 9350815, 9573526	Associate	★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	11829141, 12842373, 14695542, 15772804, 20970496, 22031115, 23165645, 26139440, 26932689, 27199453, 29475398, 30120380, 31160911, 8915974, 9595261		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 3 WITH OR WITHOUT POLYCYSTIC LIVER DISEASE	Polycystic Kidney Disease With Or Without Polycystic Liver Disease	BEFREE	23393329		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	BEFREE	10213643, 23390131, 29475398, 30511640, 31541223, 7825585, 9326320		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	UNIPROT_DG	10411676, 10541293, 10835625, 11854751, 11968093, 12707387, 14993477, 15772804, 21115670, 27071085, 27214281, 29899465, 9326320		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	CTD_human_DG	12089381, 15001556, 24719335, 25877301, 28887310, 30883612		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	GENOMICS_ENGLAND_DG	18635443, 22114106, 23431072, 29321346		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	CLINGEN_DG	10411676, 10770959, 11891195, 16135816, 23985799, 26435415, 29529603, 8650545, 9192675, 9326320, 9568711, 9573526		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	10541293, 10607831, 11264013, 11854751, 11959145, 12140187, 15482771, 16943309, 16950792, 17346947, 17370309, 17535744, 19854836, 20075061, 21636640, 22155366, 22863349, 23165645, 23418306, 23570767, 24011172, 24506938, 24847003, 25263802, 25920554, 26702651, 27730436, 27991905, 28011630, 28679762, 28967916, 30566001, 30652979, 30742069, 31251475, 31399962, 31704171, 8650545, 9175744, 9222969, 9529618, 9716661		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	LHGDN	11854751, 15780076		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	18694932, 22863349, 24009235, 24011172, 25475747, 26493500, 28154010, 28967916, 28983800, 31056860, 31251475, 32361310, 33168999, 33437033, 34064452, 34716216, 35091308, 35370030, 35627274, 35803227, 37628640, 37909612, 8182715, 9192675, 9878261	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	10097141, 10200981, 10207066, 10213643, 10369752, 10405208, 10411676, 10417277, 10469838, 10497221, 10541293, 10602361, 10655152, 10727541, 10760080, 10835625, 10873385, 10926175, 11007674, 11134244, 11140688, 11156533, 11195048, 11212307, 11245774, 11252306, 11553048, 11854751, 11863367, 11968093, 12022474, 12077489, 12087556, 12140187, 12411744, 12525172, 12527301, 12536190, 12829010, 12832751, 12842373, 14872199, 14993477, 15001556, 15100357, 15135448, 15203210, 15336986, 15717641, 15770226, 15772804, 15775720, 15780076, 15785425, 15843396, 16278216, 16279915, 16430766, 16551655, 16720597, 16943309, 16950792, 17084592, 17090781, 17100995, 17132904, 17233617, 17292589, 17370309, 18048422, 18156813, 18235088, 18257781, 18263686, 18417723, 18434273, 18505769, 18552856, 18664456, 18721488, 18725310, 18754774, 18755075, 18818683, 18826972, 18837007, 19056484, 19098310, 19158373, 19165178, 19194729, 19244406, 19265036, 19443633, 19546223, 19546862, 19686598, 19726544, 19801576, 19825331, 20168298, 20169078, 20177400, 20181743, 20219616, 20335443, 20388629, 20439752, 20558538, 20686448, 20729296, 20833712, 20938930, 20950398, 20970496, 21115670, 21126580, 21277361, 21332816, 21392577, 21396443, 21474446, 21490950, 21642537, 21719175, 21894000, 22008521, 22031115, 22034641, 22114106, 22185115, 22367170, 22383692, 22456092, 22508176, 22608885, 22863349, 23212942, 23376035, 23390129, 23390131, 23431072, 23439951, 23496908, 23570767, 23594398, 23760289, 23985799, 24071006, 24193408, 24374109, 24487363, 24491980, 24506938, 24582653, 24611717, 24658975, 24694054, 24719335, 24821069, 24898006, 25010725, 25029430, 25186187, 25361818, 25491204, 25531466, 25920554, 26077033, 26139440, 26200945, 26435415, 26453610, 26632257, 26718059, 26718155, 26823553, 26924047, 26932689, 26950445, 27046073, 27165007, 27199453, 27259053, 27401137, 27493259, 27499327, 27552964, 27567292, 27730430, 27768895, 27782177, 27793600, 27835667, 27836810, 27871310, 27881662, 27991905, 28007903, 28092368, 28154010, 28244683, 28271061, 28356211, 28432464, 28560694, 28601384, 28604386, 28620080, 28640449, 28745435, 28769124, 28782656, 28892094, 28904368, 29074972, 29378535, 29395486, 29443690, 29475398, 29515026, 29518398, 29529391, 29529603, 29559335, 29563577, 29590654, 29600752, 29633426, 29633482, 29724910, 29887830, 29899465, 29931260, 29973168, 29986647, 30120380, 30125442, 30165646, 30230107, 30242840, 30333007, 30359986, 30372813, 30378388, 30424739, 30639418, 30644092, 30651829, 30665572, 30792735, 30799240, 30816285, 30858458, 30883612, 30928102, 31056860, 31059522, 31064883, 31138767, 31186083, 31341901, 31349084, 31395386, 31399962, 31427367, 31441214, 31451534, 31488014, 31488901, 31492868, 31514750, 31556469, 31668373, 31719603, 31767049, 31773180, 31805375, 8005596, 8182715, 8591848, 8891380, 9158217, 9263688, 9286709, 9350815, 9382166, 9402976, 9595261, 9716661, 9748274, 9878261, 9949210		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	CLINVAR_DG	10411676, 10541293, 10760080, 11007674, 11968093, 12707387, 15192819, 15772804, 16540757, 17100995, 17582161, 18837007, 22383692, 22508176, 22863349, 23300259, 24374109, 25333066, 25574838, 27499327, 27782177, 28356211, 8650545		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	CLINGEN_DG	10411676, 10770959, 11891195, 16135816, 23985799, 26435415, 29529603, 8650545, 9192675, 9326320, 9568711, 9573526		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	CTD_human_DG	12089381, 15001556, 24719335, 25877301, 28887310, 30883612		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	14993477, 18754774		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	GENOMICS_ENGLAND_DG	18635443, 23431072		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Type 1 Autosomal Dominant Disease	Polycystic kidney disease	CTD_human_DG	12089381, 15001556, 24719335, 25877301, 28887310, 30883612		★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	BEFREE	22155366, 24506938, 8591848		★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	Pubtator	24706814, 26932689, 37750370	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic liver disease	Polycystic liver disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27666562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary sclerosing cholangitis	Sclerosing Cholangitis	GWASDB_DG	23603763		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22797919, 30841931		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22797919, 37611675	Associate	★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	16720597		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	19546862		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31917707	Associate	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	20686448		★☆☆☆☆ Found in Text Mining only
Situs ambiguus	Situs ambiguus	BEFREE	21719175		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	20729296		★☆☆☆☆ Found in Text Mining only
Situs inversus totalis	Situs Inversus	BEFREE	21719175		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36149789, 9880081	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	18758461		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27832627	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17962809		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	23001835	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23393329, 30845378		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	CTD_human_DG	25013951		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	29724910		★☆☆☆☆ Found in Text Mining only