Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25855
Gene name	BRMS1 transcriptional repressor and anoikis regulator
Gene symbol	BRMS1
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q13.2
Summary	This gene reduces the metastatic potential, but not the tumorogenicity, of human breast cancer and melanoma cell lines. The protein encoded by this gene localizes primarily to the nucleus and is a component of the mSin3a family of histone deacetylase comp

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003336	hsa-miR-146a-5p	Review	20026422
MIRT004633	hsa-miR-146b-5p	Review	20026422
MIRT722740	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT722739	hsa-miR-488-5p	HITS-CLIP	19536157
MIRT722738	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT722737	hsa-miR-8073	HITS-CLIP	19536157
MIRT722736	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT722735	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT722734	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT722733	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722732	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT722731	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT722730	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT722729	hsa-miR-4642	HITS-CLIP	19536157
MIRT722728	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT733530	hsa-miR-146a-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733531	hsa-miR-146b-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733532	hsa-miR-335-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733533	hsa-miR-10b-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733534	hsa-miR-373-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733535	hsa-miR-520c-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733536	hsa-miR-200b-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733537	hsa-miR-200c-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733538	hsa-miR-141-3p	Luciferase reporter assayWestern blotting	34096224
MIRT733539	hsa-miR-429	Luciferase reporter assayWestern blotting	34096224
MIRT736000	hsa-miR-147a	Luciferase reporter assayWestern blottingqRT-PCR	31628639
MIRT722740	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT722739	hsa-miR-488-5p	HITS-CLIP	19536157
MIRT722738	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT722737	hsa-miR-8073	HITS-CLIP	19536157
MIRT722736	hsa-miR-4720-5p	HITS-CLIP	19536157
MIRT722735	hsa-miR-4799-3p	HITS-CLIP	19536157
MIRT722734	hsa-miR-5588-5p	HITS-CLIP	19536157
MIRT722733	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722732	hsa-miR-6791-3p	HITS-CLIP	19536157
MIRT722731	hsa-miR-6829-3p	HITS-CLIP	19536157
MIRT722730	hsa-miR-6836-3p	HITS-CLIP	19536157
MIRT722729	hsa-miR-4642	HITS-CLIP	19536157
MIRT722728	hsa-miR-3152-5p	HITS-CLIP	19536157
MIRT825020	hsa-miR-1207-5p	CLIP-seq
MIRT825021	hsa-miR-1225-3p	CLIP-seq
MIRT825022	hsa-miR-1265	CLIP-seq
MIRT825023	hsa-miR-3119	CLIP-seq
MIRT825024	hsa-miR-3605-5p	CLIP-seq
MIRT825025	hsa-miR-3689a-3p	CLIP-seq
MIRT825026	hsa-miR-3689c	CLIP-seq
MIRT825027	hsa-miR-3689d	CLIP-seq
MIRT825028	hsa-miR-3937	CLIP-seq
MIRT825029	hsa-miR-4433	CLIP-seq
MIRT825030	hsa-miR-4459	CLIP-seq
MIRT825031	hsa-miR-4474-3p	CLIP-seq
MIRT825032	hsa-miR-4481	CLIP-seq
MIRT825033	hsa-miR-451b	CLIP-seq
MIRT825034	hsa-miR-4728-5p	CLIP-seq
MIRT825035	hsa-miR-4736	CLIP-seq
MIRT825036	hsa-miR-4745-5p	CLIP-seq
MIRT825037	hsa-miR-4763-3p	CLIP-seq
MIRT825038	hsa-miR-4764-5p	CLIP-seq
MIRT825039	hsa-miR-4768-3p	CLIP-seq
MIRT825040	hsa-miR-545	CLIP-seq
MIRT825041	hsa-miR-617	CLIP-seq
MIRT825042	hsa-miR-626	CLIP-seq
MIRT825043	hsa-miR-939	CLIP-seq
MIRT825044	hsa-miR-942	CLIP-seq
MIRT1943856	hsa-miR-4251	CLIP-seq
MIRT825020	hsa-miR-1207-5p	CLIP-seq
MIRT1943857	hsa-miR-1286	CLIP-seq
MIRT1943858	hsa-miR-4722-5p	CLIP-seq
MIRT825035	hsa-miR-4736	CLIP-seq
MIRT825037	hsa-miR-4763-3p	CLIP-seq
MIRT1943856	hsa-miR-4251	CLIP-seq
MIRT2486203	hsa-miR-125a-5p	CLIP-seq
MIRT2486204	hsa-miR-125b	CLIP-seq
MIRT825022	hsa-miR-1265	CLIP-seq
MIRT2486205	hsa-miR-128	CLIP-seq
MIRT2486206	hsa-miR-1291	CLIP-seq
MIRT2486207	hsa-miR-149	CLIP-seq
MIRT2486208	hsa-miR-324-5p	CLIP-seq
MIRT2486209	hsa-miR-328	CLIP-seq
MIRT825024	hsa-miR-3605-5p	CLIP-seq
MIRT2486210	hsa-miR-3687	CLIP-seq
MIRT2486211	hsa-miR-4261	CLIP-seq
MIRT2486212	hsa-miR-4292	CLIP-seq
MIRT2486213	hsa-miR-4308	CLIP-seq
MIRT2486214	hsa-miR-4319	CLIP-seq
MIRT2486215	hsa-miR-4442	CLIP-seq
MIRT825031	hsa-miR-4474-3p	CLIP-seq
MIRT825033	hsa-miR-451b	CLIP-seq
MIRT2486216	hsa-miR-4649-3p	CLIP-seq
MIRT2486217	hsa-miR-4738-3p	CLIP-seq
MIRT2486218	hsa-miR-4743	CLIP-seq
MIRT825038	hsa-miR-4764-5p	CLIP-seq
MIRT2486219	hsa-miR-544b	CLIP-seq
MIRT825040	hsa-miR-545	CLIP-seq
MIRT2486220	hsa-miR-596	CLIP-seq
MIRT2486221	hsa-miR-759	CLIP-seq
MIRT2486222	hsa-miR-892b	CLIP-seq
MIRT2486203	hsa-miR-125a-5p	CLIP-seq
MIRT2486204	hsa-miR-125b	CLIP-seq
MIRT825022	hsa-miR-1265	CLIP-seq
MIRT2486205	hsa-miR-128	CLIP-seq
MIRT2486206	hsa-miR-1291	CLIP-seq
MIRT2486207	hsa-miR-149	CLIP-seq
MIRT825023	hsa-miR-3119	CLIP-seq
MIRT2486208	hsa-miR-324-5p	CLIP-seq
MIRT2486209	hsa-miR-328	CLIP-seq
MIRT825024	hsa-miR-3605-5p	CLIP-seq
MIRT2486210	hsa-miR-3687	CLIP-seq
MIRT2486211	hsa-miR-4261	CLIP-seq
MIRT2486212	hsa-miR-4292	CLIP-seq
MIRT2486213	hsa-miR-4308	CLIP-seq
MIRT2486214	hsa-miR-4319	CLIP-seq
MIRT2486215	hsa-miR-4442	CLIP-seq
MIRT825031	hsa-miR-4474-3p	CLIP-seq
MIRT825033	hsa-miR-451b	CLIP-seq
MIRT2486216	hsa-miR-4649-3p	CLIP-seq
MIRT2486217	hsa-miR-4738-3p	CLIP-seq
MIRT2486218	hsa-miR-4743	CLIP-seq
MIRT825038	hsa-miR-4764-5p	CLIP-seq
MIRT2486219	hsa-miR-544b	CLIP-seq
MIRT825040	hsa-miR-545	CLIP-seq
MIRT2486220	hsa-miR-596	CLIP-seq
MIRT2486221	hsa-miR-759	CLIP-seq
MIRT2486222	hsa-miR-892b	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0005515	Function	Protein binding	IPI	16919237, 17000776, 20830743, 21258344, 23752268, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	17000776, 20830743
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	20830743
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	17000776
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	17000776
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20830743
GO:0051059	Function	NF-kappaB binding	IDA	17000776
GO:0070822	Component	Sin3-type complex	IBA
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:0090312	Process	Positive regulation of protein deacetylation	IDA	17000776
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:2000210	Process	Positive regulation of anoikis	IMP	17000776

MIM	HGNC	e!Ensembl
606259	17262	ENSG00000174744

Q9HCU9

Protein name

Breast cancer metastasis-suppressor 1

Protein function

Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controll

PDB

2XUS , 4AUV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08598	Sds3	60 → 210	Sds3-like	Family

Tissue specificity

TISSUE SPECIFICITY: Expression levels are higher in term placentas than in early placentas. Low levels of expression observed in normal pregnancies and in molar pregnancies. {ECO:0000269|PubMed:12414911}.

Sequence

MPVQPPSKDTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSEC
VSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAG
IYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEW
WDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
RKSDGP

Sequence length

246

Interactions

View interactions

	Reactome
			HDACs deacetylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

BRMS1 (BRMS1 transcriptional repressor and anoikis regulator)