Gene Gene information from NCBI Gene database.
Entrez ID 25844
Gene name Yip1 domain family member 3
Gene symbol YIPF3
Synonyms (NCBI Gene)
C6orf109FinGER3KLIP1YIPFbeta2Yip5bdJ337H4.3
Chromosome 6
Chromosome location 6p21.1
miRNA miRNA information provided by mirtarbase database.
109
miRTarBase ID miRNA Experiments Reference
MIRT052300 hsa-let-7b-5p CLASH 23622248
MIRT041315 hsa-miR-193b-3p CLASH 23622248
MIRT039935 hsa-miR-615-3p CLASH 23622248
MIRT496788 hsa-miR-624-5p PAR-CLIP 22291592
MIRT496788 hsa-miR-624-5p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 28514442, 31515488, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609775 21023 ENSG00000137207
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9GZM5
Protein name Protein YIPF3 (Killer lineage protein 1) (Natural killer cell-specific antigen KLIP1) (YIP1 family member 3) [Cleaved into: Protein YIPF3, 36 kDa form III]
Protein function Involved in the maintenance of the Golgi structure. May play a role in hematopoiesis.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed by nucleated hematopoietic cells (at protein level). {ECO:0000269|PubMed:12490290}.
Sequence
MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE
EVDADAADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRP
YFDVEPAQVRSRLLESMIPIKMVNFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIRE
GTLMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIH
LHALFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVV
EGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
Sequence length 350
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, RENAL CELL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Chromophobe Renal Cell Carcinoma Chromophobe Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only
Collecting Duct Carcinoma of the Kidney Renal Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only
Papillary Renal Cell Carcinoma Papillary Renal Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only
Renal Cell Carcinoma Renal Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma Renal Carcinoma CTD_human_DG 23797736
★☆☆☆☆
Found in Text Mining only