Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25842
Gene name	Anti-silencing function 1A histone chaperone
Gene symbol	ASF1A
Synonyms (NCBI Gene)	CGI-98CIAHSPC146
Chromosome	6
Chromosome location	6q22.31
Summary	This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with

164

Show/Hide all (164)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019628	hsa-miR-340-5p	Sequencing	20371350
MIRT020266	hsa-miR-130b-3p	Sequencing	20371350
MIRT028099	hsa-miR-93-5p	Sequencing	20371350
MIRT217679	hsa-miR-132-3p	PAR-CLIP	21572407
MIRT217678	hsa-miR-212-3p	PAR-CLIP	21572407
MIRT559425	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT244053	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559424	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT217676	hsa-miR-6083	PAR-CLIP	21572407
MIRT559423	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT217679	hsa-miR-132-3p	PAR-CLIP	21572407
MIRT217678	hsa-miR-212-3p	PAR-CLIP	21572407
MIRT559425	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT244053	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559424	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT217676	hsa-miR-6083	PAR-CLIP	21572407
MIRT559423	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT802707	hsa-miR-105	CLIP-seq
MIRT802708	hsa-miR-1231	CLIP-seq
MIRT802709	hsa-miR-1265	CLIP-seq
MIRT802710	hsa-miR-132	CLIP-seq
MIRT802711	hsa-miR-139-5p	CLIP-seq
MIRT802712	hsa-miR-2052	CLIP-seq
MIRT802713	hsa-miR-212	CLIP-seq
MIRT802714	hsa-miR-23a	CLIP-seq
MIRT802715	hsa-miR-23b	CLIP-seq
MIRT802716	hsa-miR-23c	CLIP-seq
MIRT802717	hsa-miR-27a	CLIP-seq
MIRT802718	hsa-miR-27b	CLIP-seq
MIRT802719	hsa-miR-3120-5p	CLIP-seq
MIRT802720	hsa-miR-3127-5p	CLIP-seq
MIRT802721	hsa-miR-3148	CLIP-seq
MIRT802722	hsa-miR-3168	CLIP-seq
MIRT802723	hsa-miR-3188	CLIP-seq
MIRT802724	hsa-miR-3192	CLIP-seq
MIRT802725	hsa-miR-3617	CLIP-seq
MIRT802726	hsa-miR-3647-3p	CLIP-seq
MIRT802727	hsa-miR-3689a-3p	CLIP-seq
MIRT802728	hsa-miR-3689c	CLIP-seq
MIRT802729	hsa-miR-369-3p	CLIP-seq
MIRT802730	hsa-miR-374a	CLIP-seq
MIRT802731	hsa-miR-374b	CLIP-seq
MIRT802732	hsa-miR-3978	CLIP-seq
MIRT802733	hsa-miR-412	CLIP-seq
MIRT802734	hsa-miR-4270	CLIP-seq
MIRT802735	hsa-miR-4289	CLIP-seq
MIRT802736	hsa-miR-4307	CLIP-seq
MIRT802737	hsa-miR-4314	CLIP-seq
MIRT802738	hsa-miR-4441	CLIP-seq
MIRT802739	hsa-miR-4646-5p	CLIP-seq
MIRT802740	hsa-miR-4668-3p	CLIP-seq
MIRT802741	hsa-miR-4700-3p	CLIP-seq
MIRT802742	hsa-miR-4728-5p	CLIP-seq
MIRT802743	hsa-miR-4788	CLIP-seq
MIRT802744	hsa-miR-494	CLIP-seq
MIRT802745	hsa-miR-513a-5p	CLIP-seq
MIRT802746	hsa-miR-548u	CLIP-seq
MIRT802747	hsa-miR-569	CLIP-seq
MIRT802748	hsa-miR-626	CLIP-seq
MIRT802749	hsa-miR-633	CLIP-seq
MIRT802750	hsa-miR-641	CLIP-seq
MIRT802751	hsa-miR-654-3p	CLIP-seq
MIRT802708	hsa-miR-1231	CLIP-seq
MIRT802719	hsa-miR-3120-5p	CLIP-seq
MIRT802724	hsa-miR-3192	CLIP-seq
MIRT802725	hsa-miR-3617	CLIP-seq
MIRT802727	hsa-miR-3689a-3p	CLIP-seq
MIRT802728	hsa-miR-3689c	CLIP-seq
MIRT802737	hsa-miR-4314	CLIP-seq
MIRT802739	hsa-miR-4646-5p	CLIP-seq
MIRT1937036	hsa-miR-4719	CLIP-seq
MIRT802742	hsa-miR-4728-5p	CLIP-seq
MIRT1937037	hsa-miR-561	CLIP-seq
MIRT802750	hsa-miR-641	CLIP-seq
MIRT802709	hsa-miR-1265	CLIP-seq
MIRT802711	hsa-miR-139-5p	CLIP-seq
MIRT2176826	hsa-miR-200b	CLIP-seq
MIRT2176827	hsa-miR-200c	CLIP-seq
MIRT802712	hsa-miR-2052	CLIP-seq
MIRT2176828	hsa-miR-21	CLIP-seq
MIRT802714	hsa-miR-23a	CLIP-seq
MIRT802715	hsa-miR-23b	CLIP-seq
MIRT802716	hsa-miR-23c	CLIP-seq
MIRT802720	hsa-miR-3127-5p	CLIP-seq
MIRT802722	hsa-miR-3168	CLIP-seq
MIRT2176829	hsa-miR-340	CLIP-seq
MIRT802733	hsa-miR-412	CLIP-seq
MIRT802734	hsa-miR-4270	CLIP-seq
MIRT802735	hsa-miR-4289	CLIP-seq
MIRT2176830	hsa-miR-429	CLIP-seq
MIRT802736	hsa-miR-4307	CLIP-seq
MIRT802738	hsa-miR-4441	CLIP-seq
MIRT802741	hsa-miR-4700-3p	CLIP-seq
MIRT2176831	hsa-miR-4775	CLIP-seq
MIRT802743	hsa-miR-4788	CLIP-seq
MIRT2176832	hsa-miR-590-5p	CLIP-seq
MIRT802749	hsa-miR-633	CLIP-seq
MIRT802708	hsa-miR-1231	CLIP-seq
MIRT2480157	hsa-miR-140-5p	CLIP-seq
MIRT2480158	hsa-miR-2116	CLIP-seq
MIRT802717	hsa-miR-27a	CLIP-seq
MIRT802718	hsa-miR-27b	CLIP-seq
MIRT802719	hsa-miR-3120-5p	CLIP-seq
MIRT2480159	hsa-miR-3145-3p	CLIP-seq
MIRT802724	hsa-miR-3192	CLIP-seq
MIRT2480160	hsa-miR-3194-3p	CLIP-seq
MIRT2480161	hsa-miR-3545-5p	CLIP-seq
MIRT2480162	hsa-miR-3616-5p	CLIP-seq
MIRT802725	hsa-miR-3617	CLIP-seq
MIRT2480163	hsa-miR-3647-5p	CLIP-seq
MIRT2480164	hsa-miR-3663-5p	CLIP-seq
MIRT802727	hsa-miR-3689a-3p	CLIP-seq
MIRT802728	hsa-miR-3689c	CLIP-seq
MIRT2480165	hsa-miR-375	CLIP-seq
MIRT802733	hsa-miR-412	CLIP-seq
MIRT2480166	hsa-miR-4273	CLIP-seq
MIRT802737	hsa-miR-4314	CLIP-seq
MIRT2480167	hsa-miR-4460	CLIP-seq
MIRT802739	hsa-miR-4646-5p	CLIP-seq
MIRT2480168	hsa-miR-4677-5p	CLIP-seq
MIRT802742	hsa-miR-4728-5p	CLIP-seq
MIRT2480169	hsa-miR-4753-5p	CLIP-seq
MIRT2480170	hsa-miR-4799-5p	CLIP-seq
MIRT2480171	hsa-miR-490-3p	CLIP-seq
MIRT802744	hsa-miR-494	CLIP-seq
MIRT802745	hsa-miR-513a-5p	CLIP-seq
MIRT802746	hsa-miR-548u	CLIP-seq
MIRT2480172	hsa-miR-573	CLIP-seq
MIRT2480173	hsa-miR-601	CLIP-seq
MIRT2480174	hsa-miR-607	CLIP-seq
MIRT802750	hsa-miR-641	CLIP-seq
MIRT802751	hsa-miR-654-3p	CLIP-seq
MIRT802708	hsa-miR-1231	CLIP-seq
MIRT2480157	hsa-miR-140-5p	CLIP-seq
MIRT2480158	hsa-miR-2116	CLIP-seq
MIRT802717	hsa-miR-27a	CLIP-seq
MIRT802718	hsa-miR-27b	CLIP-seq
MIRT802719	hsa-miR-3120-5p	CLIP-seq
MIRT2480159	hsa-miR-3145-3p	CLIP-seq
MIRT802724	hsa-miR-3192	CLIP-seq
MIRT2480160	hsa-miR-3194-3p	CLIP-seq
MIRT2480161	hsa-miR-3545-5p	CLIP-seq
MIRT2480162	hsa-miR-3616-5p	CLIP-seq
MIRT802725	hsa-miR-3617	CLIP-seq
MIRT2480163	hsa-miR-3647-5p	CLIP-seq
MIRT802727	hsa-miR-3689a-3p	CLIP-seq
MIRT802728	hsa-miR-3689c	CLIP-seq
MIRT2480165	hsa-miR-375	CLIP-seq
MIRT802733	hsa-miR-412	CLIP-seq
MIRT2480166	hsa-miR-4273	CLIP-seq
MIRT802737	hsa-miR-4314	CLIP-seq
MIRT2480167	hsa-miR-4460	CLIP-seq
MIRT802739	hsa-miR-4646-5p	CLIP-seq
MIRT2480168	hsa-miR-4677-5p	CLIP-seq
MIRT802742	hsa-miR-4728-5p	CLIP-seq
MIRT2480169	hsa-miR-4753-5p	CLIP-seq
MIRT2480170	hsa-miR-4799-5p	CLIP-seq
MIRT802744	hsa-miR-494	CLIP-seq
MIRT802745	hsa-miR-513a-5p	CLIP-seq
MIRT802746	hsa-miR-548u	CLIP-seq
MIRT2480172	hsa-miR-573	CLIP-seq
MIRT2480174	hsa-miR-607	CLIP-seq
MIRT802750	hsa-miR-641	CLIP-seq
MIRT802751	hsa-miR-654-3p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	18417535, 27338793, 27797818
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	14718166
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	NAS	10759893
GO:0005515	Function	Protein binding	IPI	16189514, 16980972, 19029251, 19862764, 21217774, 22407294, 23075851, 24981860, 25416956, 26167883, 26496610, 28514442, 31527615, 32296183, 33323470, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10759893
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006281	Process	DNA repair	IDA	11897662, 20545304
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IDA	11897662
GO:0006334	Process	Nucleosome assembly	IDA	14718166
GO:0006334	Process	Nucleosome assembly	IEA
GO:0006335	Process	DNA replication-dependent chromatin assembly	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0031297	Process	Replication fork processing	IDA	18417535, 27338793, 27797818, 29478807
GO:0031297	Process	Replication fork processing	IDA	29478807
GO:0032991	Component	Protein-containing complex	IDA	14718166
GO:0035861	Component	Site of double-strand break	IDA	29478807
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	10759893
GO:0042692	Process	Muscle cell differentiation	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	27338793, 27797818
GO:0140713	Function	Histone chaperone activity	IDA	10759893, 29478807
GO:0140713	Function	Histone chaperone activity	IEA
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	29478807

MIM	HGNC	e!Ensembl
609189	20995	ENSG00000111875

Q9Y294

Protein name

Histone chaperone ASF1A (Anti-silencing function protein 1 homolog A) (hAsf1) (hAsf1a) (CCG1-interacting factor A) (CIA) (hCIA)

Protein function

Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly (PubMed:10759893, PubMed:11897662, PubMed:12842904, PubMed:14718166, PubMed:15664198, PubMed:16151251, PubMed:21454

PDB

1TEY , 2I32 , 2IIJ , 2IO5 , 3AAD , 5C3I , 6F0F , 6F0G , 6F0H , 6ZUF , 7LNY , 7LO0 , 7V6Q , 8BV1 , 8CJ1 , 8CJ2 , 8CJ3 , 8Z50

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04729	ASF1_hist_chap	1 → 154	ASF1 like histone chaperone	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12842904}.

Sequence

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSV
LVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTET
ELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALP
SASKGWSTSENSLNVMLESHMDCM

Sequence length

204

Interactions

View interactions

	Reactome
			Formation of Senescence-Associated Heterochromatin Foci (SAHF)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31744829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	21483481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	24413054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30566627, 31161461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12483744, 23341540, 24836681, 26947206, 27460490, 28013195, 28249243, 28539269, 28957555, 29268189, 29361119, 30344681, 30649471, 30755337, 30800133 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	36184659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22884682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30692519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30692519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30692519	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31286799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28625518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31161461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30692519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30692519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28625518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28625518, 28943310, 30692519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31286799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21179005		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	22535842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	28704130		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	28625518, 28704130, 30692519, 31744829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31161461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28957555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	30692519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30692519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12483744, 22884682, 26947206, 28900117, 29031206, 30344681, 30649471, 31739383, 31831067, 31843461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	29031206, 31076346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	27596240		★★★★★ ★☆☆☆☆ Found in Text Mining only

ASF1A (anti-silencing function 1A histone chaperone)