Gene Gene information from NCBI Gene database.
Entrez ID 25840
Gene name Thiol methyltransferase 1A
Gene symbol TMT1A
Synonyms (NCBI Gene)
AAM-BAAMBMETTL7A
Chromosome 12
Chromosome location 12q13.12
miRNA miRNA information provided by mirtarbase database.
742
miRTarBase ID miRNA Experiments Reference
MIRT001538 hsa-miR-155-5p pSILAC 18668040
MIRT001538 hsa-miR-155-5p Proteomics;Other 18668040
MIRT022187 hsa-miR-124-3p Microarray 18668037
MIRT044794 hsa-miR-320a CLASH 23622248
MIRT517386 hsa-miR-339-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0001649 Process Osteoblast differentiation IMP 34226523
GO:0001734 Function MRNA m(6)A methyltransferase activity IEA
GO:0001734 Function MRNA m(6)A methyltransferase activity IMP 34226523
GO:0005515 Function Protein binding IPI 32814053, 34790668
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618338 24550 ENSG00000185432
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8H3
Protein name Thiol S-methyltransferase TMT1A (EC 2.1.1.9) (Methyltransferase-like protein 7A) (N6-adenosine-methyltransferase TMT1A) (EC 2.1.1.348) (Protein AAM-B) (Thiol methyltransferase 1A)
Protein function Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to alkyl and phenolic thiol-containing acceptor substrates. Together with TMT1B accounts for most of S-thiol methylation activity in the endopla
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08241 Methyltransf_11 75 172 Methyltransferase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the liver. {ECO:0000269|PubMed:37137720}.
Sequence
MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFS
NLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFE
RFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYF
MEHVAAEC
STWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYG
YAVK
Sequence length 244
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOMETRIOSIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 36647876 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 36830565 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 36830565, 37065178 Associate
★☆☆☆☆
Found in Text Mining only
Endometrioma Endometrioma CTD_human_DG 20864642
★☆☆☆☆
Found in Text Mining only
Endometriosis Endometriosis CTD_human_DG 20864642
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hypoxia Hypoxia Pubtator 30226555 Inhibit
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 34076249 Inhibit
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of thyroid Thyroid cancer BEFREE 28416772
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 28416772
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 37547717 Inhibit
★☆☆☆☆
Found in Text Mining only