Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25830
Gene name	Sulfotransferase family 4A member 1
Gene symbol	SULT4A1
Synonyms (NCBI Gene)	BR-STL-1BRSTL1DJ388M5.3NSTSULTX3hBR-STL-1
Chromosome	22
Chromosome location	22q13.31
Summary	This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizop

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments
MIRT1402934	hsa-miR-146a	CLIP-seq
MIRT1402935	hsa-miR-146b-5p	CLIP-seq
MIRT1402936	hsa-miR-298	CLIP-seq
MIRT1402937	hsa-miR-3128	CLIP-seq
MIRT1402938	hsa-miR-326	CLIP-seq
MIRT1402939	hsa-miR-330-5p	CLIP-seq
MIRT1402940	hsa-miR-4330	CLIP-seq
MIRT1402941	hsa-miR-4632	CLIP-seq
MIRT1402942	hsa-miR-4720-5p	CLIP-seq
MIRT1402943	hsa-miR-4773	CLIP-seq
MIRT1402944	hsa-miR-4799-3p	CLIP-seq
MIRT1402945	hsa-miR-589	CLIP-seq
MIRT1402946	hsa-miR-593	CLIP-seq
MIRT1402937	hsa-miR-3128	CLIP-seq
MIRT1402938	hsa-miR-326	CLIP-seq
MIRT1402939	hsa-miR-330-5p	CLIP-seq
MIRT1402941	hsa-miR-4632	CLIP-seq
MIRT1402942	hsa-miR-4720-5p	CLIP-seq
MIRT1402944	hsa-miR-4799-3p	CLIP-seq
MIRT1402946	hsa-miR-593	CLIP-seq
MIRT2120791	hsa-miR-153	CLIP-seq
MIRT1402937	hsa-miR-3128	CLIP-seq
MIRT2120792	hsa-miR-3180-5p	CLIP-seq
MIRT1402938	hsa-miR-326	CLIP-seq
MIRT1402939	hsa-miR-330-5p	CLIP-seq
MIRT2120793	hsa-miR-448	CLIP-seq
MIRT1402941	hsa-miR-4632	CLIP-seq
MIRT1402942	hsa-miR-4720-5p	CLIP-seq
MIRT1402944	hsa-miR-4799-3p	CLIP-seq
MIRT1402946	hsa-miR-593	CLIP-seq
MIRT2120794	hsa-miR-656	CLIP-seq
MIRT2342814	hsa-miR-1229	CLIP-seq
MIRT2342815	hsa-miR-197	CLIP-seq
MIRT2342816	hsa-miR-2117	CLIP-seq
MIRT1402937	hsa-miR-3128	CLIP-seq
MIRT2120792	hsa-miR-3180-5p	CLIP-seq
MIRT1402938	hsa-miR-326	CLIP-seq
MIRT1402939	hsa-miR-330-5p	CLIP-seq
MIRT2342817	hsa-miR-4273	CLIP-seq
MIRT1402941	hsa-miR-4632	CLIP-seq
MIRT1402942	hsa-miR-4720-5p	CLIP-seq
MIRT1402944	hsa-miR-4799-3p	CLIP-seq
MIRT1402946	hsa-miR-593	CLIP-seq
MIRT1402937	hsa-miR-3128	CLIP-seq
MIRT1402938	hsa-miR-326	CLIP-seq
MIRT1402939	hsa-miR-330-5p	CLIP-seq
MIRT1402941	hsa-miR-4632	CLIP-seq
MIRT1402942	hsa-miR-4720-5p	CLIP-seq
MIRT1402944	hsa-miR-4799-3p	CLIP-seq
MIRT1402946	hsa-miR-593	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19439498, 21044950, 28514442, 32152050, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006790	Process	Sulfur compound metabolic process	IEA
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008146	Function	Sulfotransferase activity	NAS	10698717
GO:0008202	Process	Steroid metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0042802	Function	Identical protein binding	IDA	32152050
GO:0042802	Function	Identical protein binding	IPI	19439498, 32296183
GO:0051923	Process	Sulfation	IBA
GO:0140059	Process	Dendrite arborization	IEA

MIM	HGNC	e!Ensembl
608359	14903	ENSG00000130540

Q9BR01

Protein name

Sulfotransferase 4A1 (ST4A1) (EC 2.8.2.-) (Brain sulfotransferase-like protein) (hBR-STL) (hBR-STL-1) (Nervous system sulfotransferase) (NST)

Protein function

Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May hav

PDB

1ZD1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00685	Sulfotransfer_1	45 → 277	Sulfotransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (

Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSL
LQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSD
LHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQ
EFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNA
EALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Sequence length

284

Interactions

View interactions

	Reactome
			Cytosolic sulfonation of small molecules

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31132460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	20376582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	22015727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24162157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14659337, 30113715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	18484683, 20815046, 21228925, 22025283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33423377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	24700646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20815046, 21336547, 24162157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16459989		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15937071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	25340730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	20815046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20376582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15937071, 17954264, 20593406, 27153443, 30150157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32348865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	18823757, 25340730		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	18823757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	16152568, 17728668, 18823757, 19125109, 25340730		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16152568, 17728668, 18823757, 19125109		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	30875393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SULT4A1 (sulfotransferase family 4A member 1)