Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25828
Gene name	Thioredoxin 2
Gene symbol	TXN2
Synonyms (NCBI Gene)	COXPD29MT-TRXMTRXTRX2TXN
Chromosome	22
Chromosome location	22q12.3
Summary	This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection ag

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs754022333	C>T	Pathogenic	Coding sequence variant, stop gained

351

Show/Hide all (351)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001402	hsa-miR-16-5p	pSILAC	18668040
MIRT001402	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT044903	hsa-miR-186-5p	CLASH	23622248
MIRT039307	hsa-miR-425-5p	CLASH	23622248
MIRT038474	hsa-miR-296-3p	CLASH	23622248
MIRT037320	hsa-miR-877-5p	CLASH	23622248
MIRT1464843	hsa-miR-128	CLIP-seq
MIRT1464844	hsa-miR-1321	CLIP-seq
MIRT1464845	hsa-miR-15a	CLIP-seq
MIRT1464846	hsa-miR-15b	CLIP-seq
MIRT1464847	hsa-miR-16	CLIP-seq
MIRT1464848	hsa-miR-1827	CLIP-seq
MIRT1464849	hsa-miR-195	CLIP-seq
MIRT1464850	hsa-miR-214	CLIP-seq
MIRT1464851	hsa-miR-27a	CLIP-seq
MIRT1464852	hsa-miR-27b	CLIP-seq
MIRT1464853	hsa-miR-29a	CLIP-seq
MIRT1464854	hsa-miR-29b	CLIP-seq
MIRT1464855	hsa-miR-29c	CLIP-seq
MIRT1464856	hsa-miR-3065-3p	CLIP-seq
MIRT1464857	hsa-miR-3157-5p	CLIP-seq
MIRT1464858	hsa-miR-3168	CLIP-seq
MIRT1464859	hsa-miR-3170	CLIP-seq
MIRT1464860	hsa-miR-3173-3p	CLIP-seq
MIRT1464861	hsa-miR-3186-3p	CLIP-seq
MIRT1464862	hsa-miR-3202	CLIP-seq
MIRT1464863	hsa-miR-3612	CLIP-seq
MIRT1464864	hsa-miR-3619-5p	CLIP-seq
MIRT1464865	hsa-miR-3943	CLIP-seq
MIRT1464866	hsa-miR-424	CLIP-seq
MIRT1464867	hsa-miR-4291	CLIP-seq
MIRT1464868	hsa-miR-4313	CLIP-seq
MIRT1464869	hsa-miR-4419a	CLIP-seq
MIRT1464870	hsa-miR-4428	CLIP-seq
MIRT1464871	hsa-miR-4446-3p	CLIP-seq
MIRT1464872	hsa-miR-4459	CLIP-seq
MIRT1464873	hsa-miR-4476	CLIP-seq
MIRT1464874	hsa-miR-4492	CLIP-seq
MIRT1464875	hsa-miR-4498	CLIP-seq
MIRT1464876	hsa-miR-4510	CLIP-seq
MIRT1464877	hsa-miR-4521	CLIP-seq
MIRT1464878	hsa-miR-4640-5p	CLIP-seq
MIRT1464879	hsa-miR-4690-3p	CLIP-seq
MIRT1464880	hsa-miR-4707-5p	CLIP-seq
MIRT1464881	hsa-miR-4726-5p	CLIP-seq
MIRT1464882	hsa-miR-4739	CLIP-seq
MIRT1464883	hsa-miR-4756-5p	CLIP-seq
MIRT1464884	hsa-miR-4779	CLIP-seq
MIRT1464885	hsa-miR-497	CLIP-seq
MIRT1464886	hsa-miR-513a-5p	CLIP-seq
MIRT1464887	hsa-miR-548aa	CLIP-seq
MIRT1464888	hsa-miR-615-5p	CLIP-seq
MIRT1464889	hsa-miR-650	CLIP-seq
MIRT1464890	hsa-miR-662	CLIP-seq
MIRT1464891	hsa-miR-761	CLIP-seq
MIRT1464892	hsa-miR-762	CLIP-seq
MIRT1464893	hsa-miR-767-3p	CLIP-seq
MIRT1464894	hsa-miR-922	CLIP-seq
MIRT2139860	hsa-miR-1266	CLIP-seq
MIRT2139861	hsa-miR-1587	CLIP-seq
MIRT2139862	hsa-miR-2355-5p	CLIP-seq
MIRT1464851	hsa-miR-27a	CLIP-seq
MIRT1464852	hsa-miR-27b	CLIP-seq
MIRT2139863	hsa-miR-3127-5p	CLIP-seq
MIRT1464862	hsa-miR-3202	CLIP-seq
MIRT2139864	hsa-miR-3672	CLIP-seq
MIRT2139865	hsa-miR-3918	CLIP-seq
MIRT2139866	hsa-miR-3925-3p	CLIP-seq
MIRT1464871	hsa-miR-4446-3p	CLIP-seq
MIRT1464874	hsa-miR-4492	CLIP-seq
MIRT1464875	hsa-miR-4498	CLIP-seq
MIRT2139867	hsa-miR-4518	CLIP-seq
MIRT2139868	hsa-miR-4533	CLIP-seq
MIRT2139869	hsa-miR-4685-5p	CLIP-seq
MIRT1464879	hsa-miR-4690-3p	CLIP-seq
MIRT2139870	hsa-miR-4705	CLIP-seq
MIRT2139871	hsa-miR-510	CLIP-seq
MIRT2139872	hsa-miR-617	CLIP-seq
MIRT2139873	hsa-miR-661	CLIP-seq
MIRT1464892	hsa-miR-762	CLIP-seq
MIRT2139874	hsa-miR-766	CLIP-seq
MIRT2360412	hsa-miR-1207-3p	CLIP-seq
MIRT2360413	hsa-miR-1254	CLIP-seq
MIRT2360414	hsa-miR-1262	CLIP-seq
MIRT1464843	hsa-miR-128	CLIP-seq
MIRT1464848	hsa-miR-1827	CLIP-seq
MIRT1464851	hsa-miR-27a	CLIP-seq
MIRT1464852	hsa-miR-27b	CLIP-seq
MIRT2360415	hsa-miR-3116	CLIP-seq
MIRT2360416	hsa-miR-3130-3p	CLIP-seq
MIRT1464857	hsa-miR-3157-5p	CLIP-seq
MIRT1464860	hsa-miR-3173-3p	CLIP-seq
MIRT2360417	hsa-miR-3190	CLIP-seq
MIRT2360418	hsa-miR-3192	CLIP-seq
MIRT1464862	hsa-miR-3202	CLIP-seq
MIRT1464863	hsa-miR-3612	CLIP-seq
MIRT2360419	hsa-miR-3622a-5p	CLIP-seq
MIRT2360420	hsa-miR-3689a-3p	CLIP-seq
MIRT2360421	hsa-miR-3689c	CLIP-seq
MIRT2360422	hsa-miR-3689d	CLIP-seq
MIRT2360423	hsa-miR-3942-3p	CLIP-seq
MIRT1464865	hsa-miR-3943	CLIP-seq
MIRT2360424	hsa-miR-3978	CLIP-seq
MIRT2360425	hsa-miR-4266	CLIP-seq
MIRT2360426	hsa-miR-4269	CLIP-seq
MIRT2360427	hsa-miR-4292	CLIP-seq
MIRT2360428	hsa-miR-4308	CLIP-seq
MIRT2360429	hsa-miR-4311	CLIP-seq
MIRT1464868	hsa-miR-4313	CLIP-seq
MIRT2360430	hsa-miR-4475	CLIP-seq
MIRT2360431	hsa-miR-4506	CLIP-seq
MIRT2139868	hsa-miR-4533	CLIP-seq
MIRT2360432	hsa-miR-4640-3p	CLIP-seq
MIRT2360433	hsa-miR-4645-5p	CLIP-seq
MIRT2360434	hsa-miR-4651	CLIP-seq
MIRT2360435	hsa-miR-4660	CLIP-seq
MIRT2360436	hsa-miR-4673	CLIP-seq
MIRT1464879	hsa-miR-4690-3p	CLIP-seq
MIRT2360437	hsa-miR-4695-5p	CLIP-seq
MIRT2360438	hsa-miR-4701-3p	CLIP-seq
MIRT2360439	hsa-miR-4728-5p	CLIP-seq
MIRT2360440	hsa-miR-4755-3p	CLIP-seq
MIRT1464884	hsa-miR-4779	CLIP-seq
MIRT2360441	hsa-miR-4793-3p	CLIP-seq
MIRT1464886	hsa-miR-513a-5p	CLIP-seq
MIRT2360442	hsa-miR-539	CLIP-seq
MIRT2360443	hsa-miR-544	CLIP-seq
MIRT1464887	hsa-miR-548aa	CLIP-seq
MIRT2360444	hsa-miR-608	CLIP-seq
MIRT2360445	hsa-miR-637	CLIP-seq
MIRT2360446	hsa-miR-646	CLIP-seq
MIRT1464889	hsa-miR-650	CLIP-seq
MIRT2139873	hsa-miR-661	CLIP-seq
MIRT2360447	hsa-miR-7	CLIP-seq
MIRT1464893	hsa-miR-767-3p	CLIP-seq
MIRT2360448	hsa-miR-875-3p	CLIP-seq
MIRT1464862	hsa-miR-3202	CLIP-seq
MIRT2139868	hsa-miR-4533	CLIP-seq
MIRT1464884	hsa-miR-4779	CLIP-seq
MIRT1464844	hsa-miR-1321	CLIP-seq
MIRT1464848	hsa-miR-1827	CLIP-seq
MIRT1464850	hsa-miR-214	CLIP-seq
MIRT1464862	hsa-miR-3202	CLIP-seq
MIRT1464863	hsa-miR-3612	CLIP-seq
MIRT1464864	hsa-miR-3619-5p	CLIP-seq
MIRT2441558	hsa-miR-3622b-5p	CLIP-seq
MIRT1464871	hsa-miR-4446-3p	CLIP-seq
MIRT1464873	hsa-miR-4476	CLIP-seq
MIRT1464874	hsa-miR-4492	CLIP-seq
MIRT1464875	hsa-miR-4498	CLIP-seq
MIRT2441559	hsa-miR-4720-5p	CLIP-seq
MIRT1464882	hsa-miR-4739	CLIP-seq
MIRT1464883	hsa-miR-4756-5p	CLIP-seq
MIRT2441560	hsa-miR-4799-3p	CLIP-seq
MIRT1464889	hsa-miR-650	CLIP-seq
MIRT1464891	hsa-miR-761	CLIP-seq
MIRT1464892	hsa-miR-762	CLIP-seq
MIRT2462688	hsa-miR-1285	CLIP-seq
MIRT2462689	hsa-miR-3187-5p	CLIP-seq
MIRT2462690	hsa-miR-331-3p	CLIP-seq
MIRT2360427	hsa-miR-4292	CLIP-seq
MIRT2462691	hsa-miR-4502	CLIP-seq
MIRT2462692	hsa-miR-612	CLIP-seq
MIRT2653902	hsa-miR-1203	CLIP-seq
MIRT2360412	hsa-miR-1207-3p	CLIP-seq
MIRT2360413	hsa-miR-1254	CLIP-seq
MIRT2139860	hsa-miR-1266	CLIP-seq
MIRT2653903	hsa-miR-1283	CLIP-seq
MIRT2462688	hsa-miR-1285	CLIP-seq
MIRT2653904	hsa-miR-1343	CLIP-seq
MIRT2653905	hsa-miR-146a	CLIP-seq
MIRT2653906	hsa-miR-146b-5p	CLIP-seq
MIRT2139861	hsa-miR-1587	CLIP-seq
MIRT1464845	hsa-miR-15a	CLIP-seq
MIRT1464846	hsa-miR-15b	CLIP-seq
MIRT1464847	hsa-miR-16	CLIP-seq
MIRT1464848	hsa-miR-1827	CLIP-seq
MIRT1464849	hsa-miR-195	CLIP-seq
MIRT1464850	hsa-miR-214	CLIP-seq
MIRT2653907	hsa-miR-2277-3p	CLIP-seq
MIRT2139862	hsa-miR-2355-5p	CLIP-seq
MIRT2653908	hsa-miR-2467-5p	CLIP-seq
MIRT2653909	hsa-miR-296-5p	CLIP-seq
MIRT1464853	hsa-miR-29a	CLIP-seq
MIRT1464854	hsa-miR-29b	CLIP-seq
MIRT1464855	hsa-miR-29c	CLIP-seq
MIRT1464856	hsa-miR-3065-3p	CLIP-seq
MIRT2360415	hsa-miR-3116	CLIP-seq
MIRT2139863	hsa-miR-3127-5p	CLIP-seq
MIRT2360416	hsa-miR-3130-3p	CLIP-seq
MIRT2653910	hsa-miR-3135b	CLIP-seq
MIRT2653911	hsa-miR-3154	CLIP-seq
MIRT1464860	hsa-miR-3173-3p	CLIP-seq
MIRT2462689	hsa-miR-3187-5p	CLIP-seq
MIRT2360418	hsa-miR-3192	CLIP-seq
MIRT2462690	hsa-miR-331-3p	CLIP-seq
MIRT1464863	hsa-miR-3612	CLIP-seq
MIRT2653912	hsa-miR-3613-3p	CLIP-seq
MIRT1464864	hsa-miR-3619-5p	CLIP-seq
MIRT2653913	hsa-miR-3652	CLIP-seq
MIRT2653914	hsa-miR-3662	CLIP-seq
MIRT2139864	hsa-miR-3672	CLIP-seq
MIRT2360420	hsa-miR-3689a-3p	CLIP-seq
MIRT2360421	hsa-miR-3689c	CLIP-seq
MIRT2653915	hsa-miR-378g	CLIP-seq
MIRT2139865	hsa-miR-3918	CLIP-seq
MIRT2139866	hsa-miR-3925-3p	CLIP-seq
MIRT2360424	hsa-miR-3978	CLIP-seq
MIRT1464866	hsa-miR-424	CLIP-seq
MIRT2653916	hsa-miR-4267	CLIP-seq
MIRT1464867	hsa-miR-4291	CLIP-seq
MIRT2360427	hsa-miR-4292	CLIP-seq
MIRT2360428	hsa-miR-4308	CLIP-seq
MIRT2360429	hsa-miR-4311	CLIP-seq
MIRT2653917	hsa-miR-4430	CLIP-seq
MIRT2653918	hsa-miR-4437	CLIP-seq
MIRT1464871	hsa-miR-4446-3p	CLIP-seq
MIRT2653919	hsa-miR-4484	CLIP-seq
MIRT1464874	hsa-miR-4492	CLIP-seq
MIRT1464875	hsa-miR-4498	CLIP-seq
MIRT2462691	hsa-miR-4502	CLIP-seq
MIRT2360431	hsa-miR-4506	CLIP-seq
MIRT2139867	hsa-miR-4518	CLIP-seq
MIRT2360432	hsa-miR-4640-3p	CLIP-seq
MIRT2360434	hsa-miR-4651	CLIP-seq
MIRT2360435	hsa-miR-4660	CLIP-seq
MIRT2653920	hsa-miR-4674	CLIP-seq
MIRT2139869	hsa-miR-4685-5p	CLIP-seq
MIRT1464879	hsa-miR-4690-3p	CLIP-seq
MIRT2139870	hsa-miR-4705	CLIP-seq
MIRT1464880	hsa-miR-4707-5p	CLIP-seq
MIRT2360439	hsa-miR-4728-5p	CLIP-seq
MIRT2653921	hsa-miR-4746-5p	CLIP-seq
MIRT2653922	hsa-miR-4747-3p	CLIP-seq
MIRT2653923	hsa-miR-4769-3p	CLIP-seq
MIRT1464884	hsa-miR-4779	CLIP-seq
MIRT2360441	hsa-miR-4793-3p	CLIP-seq
MIRT2653924	hsa-miR-4793-5p	CLIP-seq
MIRT2653925	hsa-miR-488	CLIP-seq
MIRT1464885	hsa-miR-497	CLIP-seq
MIRT2139871	hsa-miR-510	CLIP-seq
MIRT2653926	hsa-miR-520d-5p	CLIP-seq
MIRT2653927	hsa-miR-524-5p	CLIP-seq
MIRT2360442	hsa-miR-539	CLIP-seq
MIRT2360443	hsa-miR-544	CLIP-seq
MIRT2360444	hsa-miR-608	CLIP-seq
MIRT2462692	hsa-miR-612	CLIP-seq
MIRT2139872	hsa-miR-617	CLIP-seq
MIRT2360445	hsa-miR-637	CLIP-seq
MIRT2360446	hsa-miR-646	CLIP-seq
MIRT1464889	hsa-miR-650	CLIP-seq
MIRT2139873	hsa-miR-661	CLIP-seq
MIRT2360447	hsa-miR-7	CLIP-seq
MIRT1464891	hsa-miR-761	CLIP-seq
MIRT1464892	hsa-miR-762	CLIP-seq
MIRT2139874	hsa-miR-766	CLIP-seq
MIRT2360448	hsa-miR-875-3p	CLIP-seq
MIRT1464894	hsa-miR-922	CLIP-seq
MIRT2653902	hsa-miR-1203	CLIP-seq
MIRT2360412	hsa-miR-1207-3p	CLIP-seq
MIRT2360413	hsa-miR-1254	CLIP-seq
MIRT2139860	hsa-miR-1266	CLIP-seq
MIRT2653903	hsa-miR-1283	CLIP-seq
MIRT2462688	hsa-miR-1285	CLIP-seq
MIRT2653904	hsa-miR-1343	CLIP-seq
MIRT2653905	hsa-miR-146a	CLIP-seq
MIRT2653906	hsa-miR-146b-5p	CLIP-seq
MIRT2139861	hsa-miR-1587	CLIP-seq
MIRT1464845	hsa-miR-15a	CLIP-seq
MIRT1464846	hsa-miR-15b	CLIP-seq
MIRT1464847	hsa-miR-16	CLIP-seq
MIRT1464848	hsa-miR-1827	CLIP-seq
MIRT1464849	hsa-miR-195	CLIP-seq
MIRT1464850	hsa-miR-214	CLIP-seq
MIRT2653907	hsa-miR-2277-3p	CLIP-seq
MIRT2139862	hsa-miR-2355-5p	CLIP-seq
MIRT2653908	hsa-miR-2467-5p	CLIP-seq
MIRT1464853	hsa-miR-29a	CLIP-seq
MIRT1464854	hsa-miR-29b	CLIP-seq
MIRT1464855	hsa-miR-29c	CLIP-seq
MIRT1464856	hsa-miR-3065-3p	CLIP-seq
MIRT2360415	hsa-miR-3116	CLIP-seq
MIRT2139863	hsa-miR-3127-5p	CLIP-seq
MIRT2360416	hsa-miR-3130-3p	CLIP-seq
MIRT2653910	hsa-miR-3135b	CLIP-seq
MIRT2653911	hsa-miR-3154	CLIP-seq
MIRT1464860	hsa-miR-3173-3p	CLIP-seq
MIRT2462689	hsa-miR-3187-5p	CLIP-seq
MIRT2360418	hsa-miR-3192	CLIP-seq
MIRT2462690	hsa-miR-331-3p	CLIP-seq
MIRT1464863	hsa-miR-3612	CLIP-seq
MIRT2653912	hsa-miR-3613-3p	CLIP-seq
MIRT1464864	hsa-miR-3619-5p	CLIP-seq
MIRT2653913	hsa-miR-3652	CLIP-seq
MIRT2653914	hsa-miR-3662	CLIP-seq
MIRT2139864	hsa-miR-3672	CLIP-seq
MIRT2360420	hsa-miR-3689a-3p	CLIP-seq
MIRT2360421	hsa-miR-3689c	CLIP-seq
MIRT2653915	hsa-miR-378g	CLIP-seq
MIRT2139865	hsa-miR-3918	CLIP-seq
MIRT2139866	hsa-miR-3925-3p	CLIP-seq
MIRT2360424	hsa-miR-3978	CLIP-seq
MIRT1464866	hsa-miR-424	CLIP-seq
MIRT2653916	hsa-miR-4267	CLIP-seq
MIRT1464867	hsa-miR-4291	CLIP-seq
MIRT2360427	hsa-miR-4292	CLIP-seq
MIRT2360428	hsa-miR-4308	CLIP-seq
MIRT2360429	hsa-miR-4311	CLIP-seq
MIRT2653917	hsa-miR-4430	CLIP-seq
MIRT2653918	hsa-miR-4437	CLIP-seq
MIRT1464871	hsa-miR-4446-3p	CLIP-seq
MIRT2653919	hsa-miR-4484	CLIP-seq
MIRT1464874	hsa-miR-4492	CLIP-seq
MIRT1464875	hsa-miR-4498	CLIP-seq
MIRT2462691	hsa-miR-4502	CLIP-seq
MIRT2139867	hsa-miR-4518	CLIP-seq
MIRT2360432	hsa-miR-4640-3p	CLIP-seq
MIRT2360434	hsa-miR-4651	CLIP-seq
MIRT2360435	hsa-miR-4660	CLIP-seq
MIRT2653920	hsa-miR-4674	CLIP-seq
MIRT2139869	hsa-miR-4685-5p	CLIP-seq
MIRT1464879	hsa-miR-4690-3p	CLIP-seq
MIRT2139870	hsa-miR-4705	CLIP-seq
MIRT1464880	hsa-miR-4707-5p	CLIP-seq
MIRT2360439	hsa-miR-4728-5p	CLIP-seq
MIRT2653921	hsa-miR-4746-5p	CLIP-seq
MIRT2653922	hsa-miR-4747-3p	CLIP-seq
MIRT2653923	hsa-miR-4769-3p	CLIP-seq
MIRT1464884	hsa-miR-4779	CLIP-seq
MIRT2360441	hsa-miR-4793-3p	CLIP-seq
MIRT2653924	hsa-miR-4793-5p	CLIP-seq
MIRT2653925	hsa-miR-488	CLIP-seq
MIRT1464885	hsa-miR-497	CLIP-seq
MIRT2139871	hsa-miR-510	CLIP-seq
MIRT2653926	hsa-miR-520d-5p	CLIP-seq
MIRT2653927	hsa-miR-524-5p	CLIP-seq
MIRT2360442	hsa-miR-539	CLIP-seq
MIRT2360443	hsa-miR-544	CLIP-seq
MIRT2360444	hsa-miR-608	CLIP-seq
MIRT2462692	hsa-miR-612	CLIP-seq
MIRT2139872	hsa-miR-617	CLIP-seq
MIRT2360445	hsa-miR-637	CLIP-seq
MIRT2360446	hsa-miR-646	CLIP-seq
MIRT1464889	hsa-miR-650	CLIP-seq
MIRT2139873	hsa-miR-661	CLIP-seq
MIRT2360447	hsa-miR-7	CLIP-seq
MIRT1464891	hsa-miR-761	CLIP-seq
MIRT1464892	hsa-miR-762	CLIP-seq
MIRT2139874	hsa-miR-766	CLIP-seq
MIRT2360448	hsa-miR-875-3p	CLIP-seq
MIRT1464894	hsa-miR-922	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RUNX3	Repression	17956589

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21988832, 25416956, 31515488, 32296183, 32814053
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	12032145
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0015035	Function	Protein-disulfide reductase activity	IEA
GO:0045454	Process	Cell redox homeostasis	IBA

MIM	HGNC	e!Ensembl
609063	17772	ENSG00000100348

Q99757

Protein name

Thioredoxin, mitochondrial (MTRX) (Mt-Trx) (Thioredoxin-2)

Protein function

Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability (PubMed:12032145, PubMed:12080052, PubMed:26626369) Is involved in various redox reactions including the reduction of protein

PDB

1UVZ , 1W4V , 1W89

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00085	Thioredoxin	61 → 163	Thioredoxin	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult (at protein level) and fetal tissues. {ECO:0000269|PubMed:12032145, ECO:0000269|PubMed:12080052}.

Sequence

MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLT
TFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDD
HTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Sequence length

166

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Parkinson disease Salmonella infection Fluid shear stress and atherosclerosis		Degradation of cysteine and homocysteine Detoxification of Reactive Oxygen Species

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Combined oxidative phosphorylation deficiency 29	Pathogenic	rs754022333	RCV000207474	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMBINED OXIDATIVE PHOSPHORYLATION DEFECT TYPE 29	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TXN2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (322)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	24092547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	31029641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31352431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28270496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30944623, 31197039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	26325518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28866748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31352431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22447839, 28402987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10666220, 11228744, 22068231, 29138681, 2999237, 8639174, 9475178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22564527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26687188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	28356525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22119000, 31520067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11279269, 22353756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	11279269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	18996185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	9425258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28828929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30188935, 30351992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	31637257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	30188935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16046214, 17115886, 22516068, 23335265, 24086714, 27923281, 28473446, 31518877, 9714183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16678011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16622521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	10555039	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10555039	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28914370, 30853960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39531229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12744469, 17201177, 19143767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12744469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16046214, 17115886, 22516068, 23335265, 24086714, 27923281, 28473446, 31518877, 9714183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	16207716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17982132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24086714	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31028843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22051046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28442424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	8639174		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28164440, 28273832, 31144355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23762225		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	30521599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	33763469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	11292065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	10097175, 19328186, 28951984, 30447684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30706774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32418115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11163861, 11705859, 12208766, 15056229, 19566940, 21963718, 22342720, 26760912, 29190947, 30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16159878, 16712525, 16868544, 17555594, 19566940, 19620238, 21963718, 22342720, 22975630, 25416100, 26760912, 32444848, 33768386, 34979986, 37923090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19566940	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	CTD_human_DG	20812253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25106706, 29599892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	2172979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24793768, 28183007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10821495, 12208766, 15056229, 23558136, 28183007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17346424, 25004829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16635084, 18405881, 19797004, 21143527, 28667779, 30944623, 31567534, 31771972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34859284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28183007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40349025	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27779244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	28828929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29180214, 30721734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28551792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22443458, 22516068, 23335265, 27010651, 27923281, 30191719, 30932940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10558869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	24130874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28003361, 30183349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27052476, 27117068, 28851669, 30124144, 30210608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10097175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31470801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	BEFREE	28183007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31352431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18256171		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20868292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29960099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17030181, 28425040, 29434945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26114584, 29352261, 30305726, 9137526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10821495, 25004829, 27485632, 28411237, 28483515, 29053012, 29383839, 30790679, 31545552, 9042207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12878985, 17949784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27613835, 29383839, 34979986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36147458	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined oxidative phosphorylation defect type 29	Combined Oxidative Phosphorylation Deficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 29	Combined Oxidative Phosphorylation Deficiency	GENOMICS_ENGLAND_DG	26626369		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 29	Combined Oxidative Phosphorylation Deficiency	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	25800974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31310545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital microcephaly	Congenital Microcephaly	BEFREE	31735293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital microcephaly	Congenital Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17587708, 20063376, 27993729, 28212715, 28551792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18701048, 27753144, 27993729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	23691179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	23691179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	14695120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17395017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28914370, 29258883, 29548914, 30944169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	28093200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29592844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28442424, 30138646, 31473777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23328539, 28961169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28132855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17068286, 17115886, 24925443, 28926063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15128745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17068286, 17115886, 24925443, 28926063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22445099, 29751399, 37232340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24689038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17949261, 19120277, 29079703, 29593556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17949261, 25703281, 26763822, 31848914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	40076459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17360766, 30962862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	17360766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26763822, 28944891, 30384364, 30733849, 31649499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37232340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22447839, 27132507, 28402987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21360684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	15056229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	29055871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10985961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31519581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36807337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20172870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20172870, 32679649, 33572677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27779244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	30455310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26692290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17280491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	11948424, 9475178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	9475178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	11948424, 9475178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	10611262, 24130091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	11292065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	16987036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fourth cranial nerve paresis	Cranial Nerve Paralysis	BEFREE	29843669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	22882193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	23558136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	22564527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10455409, 16924499, 17699103, 20103619, 20528917, 26079827, 31738894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28345125, 30248944, 34047676, 39684695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10455409, 16924499, 17699103, 20103619, 20528917, 26079827, 29340013, 30248944, 31738894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28338004, 30680690, 7519632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36106447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	10555039	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31045571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23118946, 27733046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	37232340	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12547991	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	17587708, 27993729, 28212715, 28551792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32481311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	26210445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30010856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	28111273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	25218830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17555594, 17949261, 26480949, 28914755, 28944891, 29079703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	17555594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	18976655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	25218830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	25106706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22016650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17280491, 22443458, 28130258, 28179506, 29445879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30721734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30721734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	26955974, 29079703, 29593556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	32839348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	14742261, 17959730, 33493155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16513844, 22342720, 28914370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28854338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21088339	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28775044		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28680529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	38147024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	8971189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28093200, 29960099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	23328539		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	27881117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	30721734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28828929, 30447684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	BEFREE	17360648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17360766, 28146117, 30733849, 31478545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lactate Dehydrogenase B Deficiency	Lactate Dehydrogenase B Deficiency	BEFREE	31018154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	2172979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27158980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30774430, 31730934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11228744, 22068231, 29138681, 29749372, 8639174, 9475178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16574106, 17346424, 25004829, 26752068, 29569721, 30288659, 30382079, 31648804, 31652503, 8968078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	19951583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29146100, 29599892, 30785345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	21088339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14703116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33528895, 33760130, 34939468, 38013118, 40349025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18422776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23118946, 27733046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24885895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	27032653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11163861, 11705859, 19566940, 21963718, 22342720, 26760912, 29190947, 30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31519581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16635084, 18405881, 19797004, 28667779, 30944623, 31567534, 31771972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15150118, 22530568, 26983463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20955789, 21718176, 23133653, 24269899, 29089489, 29697282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23558136, 30911354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28440491, 29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11035260, 12744469, 16428932, 18045191, 18202017, 18793260, 19439228, 20435060, 21327297, 21908620, 22750447, 23812635, 25620030, 26169724, 27485632 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19566940, 26114584, 29352261, 30305726, 9137526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	30396169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	32418115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17699103, 24008424, 30257313		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24008424	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	28843270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28442424, 30138646, 31473777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28442424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11269944, 14987796, 16647070, 26936390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	38013118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20435060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30932940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29959620, 33763469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	29960099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21910912, 25945832, 32820006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25945832, 28028022, 29482577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25492529, 28844667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26460262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	14654070, 20194885, 25703281, 26933812, 27587398, 30131176, 31811327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	18701048, 27753144, 27993729, 28807201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	LHGDN	12870673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27615269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16158536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28107202, 31006996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28107202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	12744469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10821495, 11370665, 11705859, 12208766, 12744469, 15056229, 15166090, 15754001, 16428932, 19439228, 19566940, 20650313, 21069338, 21637159, 22248473 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18996185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	30706774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	19165900, 23982205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	19165900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14500366, 21704743, 25231459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15803370, 28600984, 31801208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15685369, 20202476, 28944891, 30769159, 31649499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16397226, 17640298, 29383158, 29989053, 31541631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	30455310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21593104, 29459183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	26329592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	29927677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19146996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	12032145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	12032145, 19165900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25483711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15150118, 22530568, 26983463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22530568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16987036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	15166090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21815648, 29960099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34732784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	33763469, 33868574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28807201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	28866748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	12744469, 30530705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30861284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	17360648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29852184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20955789, 21718176, 23133653, 24269899, 29089489, 29697282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12189205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17030815, 20955789, 24269899, 28391184, 29089489, 29697282, 35508713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23762225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	30455310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33493155, 39349929, 39766355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	18256171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	12744884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27436123, 28775044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37944440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rachischisis	Rachischisis	CTD_human_DG	19165900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	31105565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	17360766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	24024160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29512754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	24024160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28981107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16678011, 17516242, 22325059, 28914370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15581626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27871032, 28442424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28132855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	40613196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27299588, 28087409, 28505020, 28806702, 29180214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	31751569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	9475178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19581829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30159112	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19581829, 29992456, 30159112, 31309463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30944623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	19165900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	CTD_human_DG	19165900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28904321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	28183007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23118946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Dysraphicus	Status Dysraphicus	CTD_human_DG	19165900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31280865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23558136, 30911354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16513844, 23112551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24793768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subaortic stenosis	Subaortic Stenosis	BEFREE	30721734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28132855		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16301999, 28864268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28440491, 29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28440491, 29371830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	27117068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	27117068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30396169, 31090219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28700735, 29434945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	14742261, 26439985, 26758418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10611262, 24130091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22531461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	24799429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TXN2 (thioredoxin 2)