PRDX5 (peroxiredoxin 5)

Gene

• Entrez ID: 25824
• Gene name: Peroxiredoxin 5
• Gene symbol: PRDX5
• Synonyms (NCBI Gene): ACR1, AOEB166, B166, HEL-S-55, PLP, PMP20, PRDX6, PRXV, SBBI10, prx-V
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT037717	hsa-miR-744-5p	CLASH	23622248
MIRT470292	hsa-miR-302f	PAR-CLIP	23592263
MIRT470291	hsa-miR-1265	PAR-CLIP	23592263
MIRT470290	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT470289	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT470288	hsa-miR-1205	PAR-CLIP	23592263
MIRT470287	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470286	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT470285	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470284	hsa-miR-1286	PAR-CLIP	23592263
MIRT470282	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470283	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT737179	hsa-miR-6855-3p	Luciferase reporter assay, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	31987042
MIRT738987	hsa-miR-1909	HITS-CLIP	33718276
MIRT738988	hsa-miR-543	HITS-CLIP	33718276
MIRT470292	hsa-miR-302f	PAR-CLIP	23592263
MIRT470291	hsa-miR-1265	PAR-CLIP	23592263
MIRT470290	hsa-miR-3688-3p	PAR-CLIP	23592263
MIRT470289	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT470288	hsa-miR-1205	PAR-CLIP	23592263
MIRT470287	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470286	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT470285	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT470284	hsa-miR-1286	PAR-CLIP	23592263
MIRT470282	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT470283	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1260565	hsa-miR-137	CLIP-seq
MIRT1260566	hsa-miR-25	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260567	hsa-miR-298	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260568	hsa-miR-32	CLIP-seq
MIRT1260569	hsa-miR-363	CLIP-seq
MIRT1260570	hsa-miR-367	CLIP-seq
MIRT1260571	hsa-miR-3678-3p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260572	hsa-miR-92a	CLIP-seq
MIRT1260573	hsa-miR-92b	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT1260545	hsa-miR-125a-3p	CLIP-seq
MIRT1260546	hsa-miR-1285	CLIP-seq
MIRT1260547	hsa-miR-1321	CLIP-seq
MIRT1260565	hsa-miR-137	CLIP-seq
MIRT1260566	hsa-miR-25	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260567	hsa-miR-298	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260549	hsa-miR-3162-5p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT1260551	hsa-miR-3187-5p	CLIP-seq
MIRT1260568	hsa-miR-32	CLIP-seq
MIRT1260569	hsa-miR-363	CLIP-seq
MIRT1260552	hsa-miR-3665	CLIP-seq
MIRT1260570	hsa-miR-367	CLIP-seq
MIRT1260571	hsa-miR-3678-3p	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260556	hsa-miR-4492	CLIP-seq
MIRT1260557	hsa-miR-4498	CLIP-seq
MIRT1260558	hsa-miR-4505	CLIP-seq
MIRT1552551	hsa-miR-4651	CLIP-seq
MIRT1552552	hsa-miR-4728-5p	CLIP-seq
MIRT1260559	hsa-miR-4736	CLIP-seq
MIRT1260560	hsa-miR-4739	CLIP-seq
MIRT1260561	hsa-miR-4756-5p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq
MIRT1552553	hsa-miR-608	CLIP-seq
MIRT1260563	hsa-miR-612	CLIP-seq
MIRT1260564	hsa-miR-762	CLIP-seq
MIRT1552554	hsa-miR-765	CLIP-seq
MIRT1260572	hsa-miR-92a	CLIP-seq
MIRT1260573	hsa-miR-92b	CLIP-seq
MIRT738985	hsa-miR-296-5p	CLIP-seq
MIRT1260548	hsa-miR-3126-3p	CLIP-seq
MIRT1260550	hsa-miR-3176	CLIP-seq
MIRT738986	hsa-miR-3918	CLIP-seq
MIRT1260553	hsa-miR-3922-3p	CLIP-seq
MIRT1260554	hsa-miR-3926	CLIP-seq
MIRT1260555	hsa-miR-4446-3p	CLIP-seq
MIRT1260562	hsa-miR-548s	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DEK	Repression	19229864
NRF1	Activation	21051700

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001016	Function	RNA polymerase III transcription regulatory region sequence-specific DNA binding	IDA	10095767
GO:0004601	Function	Peroxidase activity	IDA	10521424
GO:0004601	Function	Peroxidase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	10514471
GO:0005515	Function	Protein binding	IPI	10514471, 29128334, 32296183
GO:0005615	Component	Extracellular space	HDA	23580065
GO:0005634	Component	Nucleus	IDA	10095767, 15785239
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10514471, 15785239
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	10521424, 10751410, 18262354, 31740833
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	10521424, 10751410
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IDA	10514471
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005829	Component	Cytosol	IDA	18262354
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	TAS	10521424
GO:0006979	Process	Response to oxidative stress	IDA	10514471, 10521424
GO:0008379	Function	Thioredoxin peroxidase activity	EXP	15280035
GO:0008379	Function	Thioredoxin peroxidase activity	IBA
GO:0008379	Function	Thioredoxin peroxidase activity	IDA	10751410
GO:0008379	Function	Thioredoxin peroxidase activity	IEA
GO:0016209	Function	Antioxidant activity	IDA	10514471
GO:0016209	Function	Antioxidant activity	IEA
GO:0016480	Process	Negative regulation of transcription by RNA polymerase III	IDA	10095767
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	10095767
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	15276323
GO:0034599	Process	Cellular response to oxidative stress	IBA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	TAS
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	18262354
GO:0042744	Process	Hydrogen peroxide catabolic process	IBA
GO:0042744	Process	Hydrogen peroxide catabolic process	IDA	10514471
GO:0042802	Function	Identical protein binding	IPI	15046979
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	18262354
GO:0043066	Process	Negative regulation of apoptotic process	IMP	18262354
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	15785239
GO:0045454	Process	Cell redox homeostasis	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10095767
GO:0051354	Process	Negative regulation of oxidoreductase activity	IDA	15280035
GO:0060785	Process	Regulation of apoptosis involved in tissue homeostasis	IDA	15276323
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0072541	Function	Peroxynitrite reductase activity	IDA	15280035
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140824	Function	Thioredoxin-dependent peroxiredoxin activity	IEA
GO:2001057	Process	Reactive nitrogen species metabolic process	IDA	15280035

Other IDs

• MIM: 606583
• HGNC: 9355
• e!Ensembl: ENSG00000126432

Protein

• UniProt ID: P30044
• Protein name: Peroxiredoxin-5, mitochondrial (EC 1.11.1.24) (Alu corepressor 1) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 71B) (PLP) (Peroxiredoxin V) (Prx-V) (Peroxisomal antioxidant enzyme) (TPx type VI) (Thioredoxin peroxidase PMP20) (Thioredoxi
• Protein function: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrog
• PDB: 1H4O, 1HD2, 1OC3, 1URM, 2VL2, 2VL3, 2VL9, 3MNG, 4K7I, 4K7N, 4K7O, 4MMM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08534	Redoxin	57 → 211	Redoxin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10521424}.
• Sequence:

  MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGD
  AIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGV
  QVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKR
  FSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

• Sequence length: 214

Pathways

KEGG:

Peroxisome

Reactome:

Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24583460		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20195699		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30562740		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	20231622	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31519597		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31500275		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	CTD_human_DG	20596022		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	26919450		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	15509539		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
Anterior subcapsular cataract	Subcapsular cataract	BEFREE	16360653		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	27934969	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	32273946, 37445606	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26211509, 29194002, 29695052, 31636630		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10555039	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12744469		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22051046	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	9446782		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29897571		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	28660949		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	29717219	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28596967		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30706774		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17980029, 22020876, 23216744, 23489758, 26760912, 28945070, 29966525		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	1720785, 19620238, 22975630, 31839604, 33768386, 37268731, 9774665	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19893992, 34517184	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15056229, 24316730		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26847304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19893992, 35318110	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19937138, 24512906, 24618722, 26061816, 27917873		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26731315, 9446782		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30191719		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	16360653, 19429582, 30120980, 31832924		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	11274318, 24243499		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	24243499		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38287382	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28424593, 28596967		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	27554973		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34320944	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	30039470		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	9740165		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	10586248, 10586260, 29970109		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28199527		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12151345, 22294162, 28431931, 31262894, 31704839		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34761597	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30562740		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22294162, 30562740, 36935009	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	9042207		★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22497500		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31852111	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	26176707, 31257073		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23273104		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12417342		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	12417342		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	12213717	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	8909455		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	10493736		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29022236		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	31382646		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29160110		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36466094, 37554330, 40076459	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31519597		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	CTD_human_DG	11771762		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12650976		★☆☆☆☆ Found in Text Mining only
Down Syndrome, Partial Trisomy 21	Down Syndrome	CTD_human_DG	11771762		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	29055871	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	22415234		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29541251		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22415234	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30483512		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26731315		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	19748926, 22448250		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	19748926, 22448250		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31505325		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	24316730		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	22882193	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	19572226		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29992497		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15785239		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	11470961, 12210342, 8780101		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31652719		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	19424620		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	30289311		★☆☆☆☆ Found in Text Mining only
Hereditary X-Linked Recessive Spastic Paraplegia	Spastic paraplegia	BEFREE	11535114, 12580714, 18783902		★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	3346559		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31500275		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30120980		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	9740165		★☆☆☆☆ Found in Text Mining only
Hypophosphatasia	Hypophosphatasia	BEFREE	30289311, 7706447		★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	31302330		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19016754, 24265281	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26647763, 36935009	Inhibit	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	29912414	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24391750	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29906559		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30918891		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	38057357	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	38057357	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28881633		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	9740165		★☆☆☆☆ Found in Text Mining only
LEBER CONGENITAL AMAUROSIS, TYPE II (disorder)	Leber Congenital Amaurosis	BEFREE	22953002		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31730934		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	10401787, 12230321		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	12213717	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31527445		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16088946, 28218611, 31384178, 31500275, 31577978		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	38057357	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	38057357	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9792801		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19937138, 33416106	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	23692979		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24512906		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31769215		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33416106	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	31852111	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28222113	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17980029, 22020876, 23216744, 23489758, 26760912, 28945070, 29966525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29541251		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21468086		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	12151345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31808475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30272318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19937138, 24512906, 24618722, 26061816, 30401714, 31500275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	23692979		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	9446782		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27871003		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15342369, 21796653, 23133653		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	19424620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31836775		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12744469, 18045191, 19769465, 20864247, 22294162, 22539432, 25448488, 28001402, 28281377, 29109765, 29582524, 29727025, 29775743, 29939757, 29966525, 30178635, 30496814, 30562740, 30791480, 30898620, 31500275, 31519597, 31819528, 9354464, 9446782, 9792801		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12151345, 20195699, 22294162, 28431931, 31262894, 31704839		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17980029		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	37445606	Associate	★☆☆☆☆ Found in Text Mining only
MASA SYNDROME (disorder)	MASA syndrome	BEFREE	7635479, 9268109, 9934976		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19383853	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23284172, 26176707, 26285655, 28532129, 31257073		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29022236		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29777756, 31505325		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29327078		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15695408		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29959620	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26795735, 28028022, 31514052		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26795735	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10541588, 20078558, 28191734, 9460711		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	15788534		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31828114		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	30289745		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16158536		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1451100, 15056229, 15695408, 17980029, 18324346, 19769465, 20003713, 20864247, 24512906, 24618722, 26061816, 27485632, 27917873, 28177228, 28270080, 28532129, 29109765, 29582524, 29689709, 30272318, 30410598, 30496814, 30963763, 31819528, 9815752		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18262354, 28383113, 28600984		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29906559, 31358548		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31505325		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21562407, 25433998, 27917873, 29689709, 30804354, 31819528		★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	16360653		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	11071483		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29777756		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	29927677		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	17653765		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	17653765	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12417342	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23937207	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	38287382	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	9446782		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23696862, 30104402, 30756364	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27871003		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24316730		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	12213717	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18262354		★☆☆☆☆ Found in Text Mining only
Pelizaeus-Merzbacher Disease	Pelizaeus-Merzbacher disease	BEFREE	10401787, 10493736, 10586248, 10586260, 10588103, 10651021, 10767322, 10878666, 11071483, 11535114, 11536268, 11786921, 12230321, 12580714, 12910435, 1376553, 1376966, 15753308, 16207216, 1676565, 1707231, 1720927, 18783902, 20637281, 21177054, 21784154, 2480601, 29027761, 30195779, 7488049, 7509234, 7539211, 7539212, 7541731, 7574457, 7635479, 7683951, 7684886, 7684945, 7915877, 8659540, 8733901, 8780101, 8782167, 8786077, 9008538, 9268109, 9305348, 9633722, 9634530, 9672418, 9747038, 9934976		★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	10586260		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	12650976, 16186110		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	16186110		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	12744469		★☆☆☆☆ Found in Text Mining only
Platelet Storage Pool Deficiency	Platelet Storage Pool Deficiency	BEFREE	8274781		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	16360653		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	8909455		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	24990153		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15342369, 21796653, 23133653		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21031435, 21796653, 23133653, 27197287, 28069826	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22482804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37329238	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29118902		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37944440	Associate	★☆☆☆☆ Found in Text Mining only
Pyridoxamine 5-Prime-Phosphate Oxidase Deficiency	Pyridoxamine 5-Prime-Phosphate Oxidase Deficiency	BEFREE	21292558		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31808475		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	28981107	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17516242, 26211509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	19165527		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19405953		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	19405953		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	19405953	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Ataxia	Spastic Ataxia	BEFREE	11071483		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia	Spastic Paraplegia	BEFREE	9672418		★☆☆☆☆ Found in Text Mining only
SPASTIC PARAPLEGIA 2, X-LINKED (disorder)	Hereditary spastic paraplegia	BEFREE	11535114, 18783902, 7635479, 8780101		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	29970109		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30410598		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24386210, 31517839, 34853622	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31836775		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	27743162	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	19424620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	20829884, 28423550, 31280208	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	35645108	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Striatonigral Degeneration	Striatonigral Degeneration	BEFREE	29298733		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29371830		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30370633, 31090219		★☆☆☆☆ Found in Text Mining only
Trisomy 21, Meiotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★☆☆☆☆ Found in Text Mining only
Trisomy 21, Mitotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	37443747	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26758418	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	23603921		★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	34070501	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	12823440, 29207142, 8274781		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	12823440, 29207142, 8274781		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	1801654		★☆☆☆☆ Found in Text Mining only