NOCT (nocturnin)

Gene

• Entrez ID: 25819
• Gene name: Nocturnin
• Gene symbol: NOCT
• Synonyms (NCBI Gene): CCR4L, CCRN4L, Ccr4c, NOC
• Chromosome: 4
• Chromosome location: 4q31.1
• Summary: The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT740740	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT740741	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT740742	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT740743	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT740744	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT740745	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT740746	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT740747	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT740748	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT740749	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT740750	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT740751	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT740752	hsa-miR-302e	HITS-CLIP	23313552
MIRT740753	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT740754	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT740755	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT740756	hsa-miR-520b	HITS-CLIP	23313552
MIRT740757	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT740758	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT740759	hsa-miR-520e	HITS-CLIP	23313552
MIRT740760	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT740761	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT740762	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT740763	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT740764	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT740765	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT740766	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT754414	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT754415	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT754416	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT754417	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT754418	hsa-miR-4522	PAR-CLIP	21572407
MIRT754419	hsa-miR-3135a	PAR-CLIP	21572407
MIRT754420	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT754421	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT754422	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT754423	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT754424	hsa-miR-6510-3p	PAR-CLIP	21572407
MIRT754790	hsa-miR-3121-3p	PAR-CLIP	22291592

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000175	Function	3'-5'-RNA exonuclease activity	IBA
GO:0000290	Process	Deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0003729	Function	MRNA binding	ISS
GO:0003824	Function	Catalytic activity	IEA
GO:0004535	Function	Poly(A)-specific ribonuclease activity	IEA
GO:0004535	Function	Poly(A)-specific ribonuclease activity	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	10521507
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	31147539
GO:0005739	Component	Mitochondrion	IEA
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10521507
GO:0006739	Process	NADP+ metabolic process	IDA	31147539
GO:0007623	Process	Circadian rhythm	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IEA
GO:0019178	Function	NADP phosphatase activity	IDA	31147539
GO:0019178	Function	NADP phosphatase activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033962	Process	P-body assembly	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	ISS
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0048255	Process	MRNA stabilization	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0102757	Function	NADPH phosphatase activity	IDA	31147539
GO:0102757	Function	NADPH phosphatase activity	IEA

Other IDs

• MIM: 608468
• HGNC: 14254
• e!Ensembl: ENSG00000151014

Protein

• UniProt ID: Q9UK39
• Protein name: Nocturnin (EC 3.1.3.108) (Carbon catabolite repression 4-like protein)
• Protein function: Phosphatase which catalyzes the conversion of NADP(+) to NAD(+) and of NADPH to NADH (PubMed:31147539). Shows a small preference for NADPH over NADP(+) (PubMed:31147539). Represses translation and promotes degradation of target mRNA molecules (P
• PDB: 6BT1, 6BT2, 6MAL, 6NF0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03372	Exo_endo_phos	146 → 414	Endonuclease/Exonuclease/phosphatase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Adipose tissue. Expression is higher in subcutaneous adipose tissue as compared to visceral adipose tissue. {ECO:0000269|PubMed:22331129}.
• Sequence:

  MFHSPRRLCSALLQRDAPGLRRLPAPGLRRPLSPPAAVPRPASPRLLAAASAASGAARSC
  SRTVCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHT
  RPPRFQRDFVDLRTDCPSTHPPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLIL
  EEILAYQPDILCLQEVDHYFDTFQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFF
  LQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQ
  GCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSADGQSEPP
  YTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCD
  FSFTEESDGLS

• Sequence length: 431

Pathways

Reactome:

BMAL1:CLOCK,NPAS2 activates circadian gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	25114068	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	12456315		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30200073		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24821610		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26541675	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22608110		★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	20425445		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16821125		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26541675	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29924023		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24821610		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30200073		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	31467910	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22552400		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27922538, 30200073		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24821610		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20820194, 22608110, 29386110		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23922759	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31354022		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29851772		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29924023		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26541675		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22608110		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12456315, 14959850		★☆☆☆☆ Found in Text Mining only