Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25816
Gene name	TNF alpha induced protein 8
Gene symbol	TNFAIP8
Synonyms (NCBI Gene)	GG2-1MDC-3.13NDEDSCC-S2SCCS2
Chromosome	5
Chromosome location	5q23.1

180

Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053458	hsa-miR-452-5p	Microarray	23807165
MIRT720775	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	19536157
MIRT720774	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT720773	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	19536157
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	19536157
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	19536157
MIRT625207	hsa-miR-23c	HITS-CLIP	19536157
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT652329	hsa-miR-541-3p	HITS-CLIP	23824327
MIRT652328	hsa-miR-654-5p	HITS-CLIP	23824327
MIRT652327	hsa-miR-92a-2-5p	HITS-CLIP	23824327
MIRT652326	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT652325	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT652329	hsa-miR-541-3p	HITS-CLIP	23824327
MIRT652328	hsa-miR-654-5p	HITS-CLIP	23824327
MIRT652327	hsa-miR-92a-2-5p	HITS-CLIP	23824327
MIRT652326	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT652325	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT720775	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	19536157
MIRT720774	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT720773	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	19536157
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	19536157
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	19536157
MIRT625207	hsa-miR-23c	HITS-CLIP	19536157
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT652329	hsa-miR-541-3p	HITS-CLIP	23824327
MIRT652328	hsa-miR-654-5p	HITS-CLIP	23824327
MIRT652327	hsa-miR-92a-2-5p	HITS-CLIP	23824327
MIRT652326	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT652325	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT652329	hsa-miR-541-3p	HITS-CLIP	23824327
MIRT652328	hsa-miR-654-5p	HITS-CLIP	23824327
MIRT652327	hsa-miR-92a-2-5p	HITS-CLIP	23824327
MIRT652326	hsa-miR-6769a-5p	HITS-CLIP	23824327
MIRT652325	hsa-miR-6769b-5p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT634982	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT634981	hsa-miR-147a	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625214	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT625213	hsa-miR-630	HITS-CLIP	23824327
MIRT625212	hsa-miR-223-5p	HITS-CLIP	23824327
MIRT625211	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT625210	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT625209	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT625208	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT625207	hsa-miR-23c	HITS-CLIP	23824327
MIRT625206	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1442280	hsa-miR-1271	CLIP-seq
MIRT1442281	hsa-miR-182	CLIP-seq
MIRT1442282	hsa-miR-2116	CLIP-seq
MIRT1442283	hsa-miR-3140-3p	CLIP-seq
MIRT1442284	hsa-miR-3609	CLIP-seq
MIRT1442285	hsa-miR-3671	CLIP-seq
MIRT1442286	hsa-miR-4274	CLIP-seq
MIRT1442287	hsa-miR-4519	CLIP-seq
MIRT1442288	hsa-miR-4524	CLIP-seq
MIRT1442289	hsa-miR-4659a-3p	CLIP-seq
MIRT1442290	hsa-miR-4659b-3p	CLIP-seq
MIRT1442291	hsa-miR-4677-5p	CLIP-seq
MIRT1442292	hsa-miR-548ah	CLIP-seq
MIRT1442293	hsa-miR-548t	CLIP-seq
MIRT1442294	hsa-miR-607	CLIP-seq
MIRT1442295	hsa-miR-96	CLIP-seq
MIRT1442296	hsa-miR-1227	CLIP-seq
MIRT1442297	hsa-miR-455-5p	CLIP-seq
MIRT1442298	hsa-miR-4715-3p	CLIP-seq
MIRT2132420	hsa-miR-3658	CLIP-seq
MIRT2132421	hsa-miR-376c	CLIP-seq
MIRT2132422	hsa-miR-451b	CLIP-seq
MIRT1442296	hsa-miR-1227	CLIP-seq
MIRT1442297	hsa-miR-455-5p	CLIP-seq
MIRT1442298	hsa-miR-4715-3p	CLIP-seq
MIRT1442296	hsa-miR-1227	CLIP-seq
MIRT1442297	hsa-miR-455-5p	CLIP-seq
MIRT1442298	hsa-miR-4715-3p	CLIP-seq
MIRT1442296	hsa-miR-1227	CLIP-seq
MIRT2647488	hsa-miR-1263	CLIP-seq
MIRT2647489	hsa-miR-146a	CLIP-seq
MIRT2647490	hsa-miR-146b-5p	CLIP-seq
MIRT1442282	hsa-miR-2116	CLIP-seq
MIRT2647491	hsa-miR-3127-3p	CLIP-seq
MIRT2647492	hsa-miR-3137	CLIP-seq
MIRT2647493	hsa-miR-3180-5p	CLIP-seq
MIRT2647494	hsa-miR-329	CLIP-seq
MIRT2647495	hsa-miR-362-3p	CLIP-seq
MIRT2647496	hsa-miR-4251	CLIP-seq
MIRT1442286	hsa-miR-4274	CLIP-seq
MIRT2647497	hsa-miR-4303	CLIP-seq
MIRT2647498	hsa-miR-4329	CLIP-seq
MIRT2647499	hsa-miR-4428	CLIP-seq
MIRT1442287	hsa-miR-4519	CLIP-seq
MIRT1442288	hsa-miR-4524	CLIP-seq
MIRT1442297	hsa-miR-455-5p	CLIP-seq
MIRT1442291	hsa-miR-4677-5p	CLIP-seq
MIRT2647500	hsa-miR-4699-5p	CLIP-seq
MIRT2647501	hsa-miR-4713-5p	CLIP-seq
MIRT1442298	hsa-miR-4715-3p	CLIP-seq
MIRT2647502	hsa-miR-4749-3p	CLIP-seq
MIRT2647503	hsa-miR-4762-3p	CLIP-seq
MIRT2647504	hsa-miR-491-3p	CLIP-seq
MIRT2647505	hsa-miR-520a-5p	CLIP-seq
MIRT2647506	hsa-miR-525-5p	CLIP-seq
MIRT2647507	hsa-miR-539	CLIP-seq
MIRT2647508	hsa-miR-642b	CLIP-seq
MIRT2647509	hsa-miR-885-5p	CLIP-seq
MIRT2647503	hsa-miR-4762-3p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14724590
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA
GO:0043027	Function	Cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	10644768
GO:0043065	Process	Positive regulation of apoptotic process	IMP	10644768
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10644768

MIM	HGNC	e!Ensembl
612111	17260	ENSG00000145779

O95379

Protein name

Tumor necrosis factor alpha-induced protein 8 (TNF alpha-induced protein 8) (Head and neck tumor and metastasis-related protein) (MDC-3.13) (NF-kappa-B-inducible DED-containing protein) (NDED) (SCC-S2) (TNF-induced protein GG2-1)

Protein function

Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavag

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05527	DUF758	16 → 196	Domain of unknown function (DUF758)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the s

Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTRE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI

Sequence length

198

Interactions

View interactions

	Reactome
			PI Metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (77)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	23280553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29725261		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30944654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22631659, 31929755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33707587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28152516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	38615592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20398053, 28926138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23982604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33707587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23982604, 30107189, 30546405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28087477		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23299407, 30944654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23299407, 30944654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25948814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22886548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30216108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22886548, 30216108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30216108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20699119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31043860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24590269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23982604, 30546405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32432789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26886285	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34344926	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38615592	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29488604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	39277575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28087477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28152516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	24329858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22631659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22886548, 24590269, 25936980, 30216108	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	25936980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	22666399, 23840460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	22666399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27807832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31043860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20398053, 28926138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30107189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19893039, 23280553, 29928491, 30586922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25936980, 28127811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16207477, 16455304, 23280553, 23299407, 23982604, 25479791, 25936980, 25948814, 27807832, 27834950, 28087477, 28926138, 29620232, 29920292, 30064446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23299407, 30944654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22886548		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27807832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33707587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33256380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34488019, 36571271	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	14724590, 16455304, 21969086, 23280553, 23982604, 25936980, 27341992, 27656836, 27807832, 28081733, 28087477, 28127811, 29042962, 29928491, 30107189, 30216108 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20398053, 30064446, 30647104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29042962		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30107189		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	23280553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22631659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19893039, 23280553, 29928491, 30586922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16207477, 16394135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33227392	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29488604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	33707587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21969086, 30616477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21969086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	9307729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	9307729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25936980, 28127811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25936980	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28127811, 39294296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFAIP8 (TNF alpha induced protein 8)