Gene Gene information from NCBI Gene database.
Entrez ID 25805
Gene name BMP and activin membrane bound inhibitor
Gene symbol BAMBI
Synonyms (NCBI Gene)
NMA
Chromosome 10
Chromosome location 10p12.1
Summary This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encode
miRNA miRNA information provided by mirtarbase database.
695
miRTarBase ID miRNA Experiments Reference
MIRT004121 hsa-miR-20b-5p Luciferase reporter assayqRT-PCR 21042576
MIRT004121 hsa-miR-20b-5p Luciferase reporter assayqRT-PCR 21042576
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT006755 hsa-miR-20a-5p Luciferase reporter assay 21743293
MIRT016041 hsa-miR-374b-5p Sequencing 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
FOXF2 Activation 19562724
HDAC1 Repression 24448807
SMAD3 Activation 15240101
SMAD4 Activation 15240101
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0005109 Function Frizzled binding IBA
GO:0005109 Function Frizzled binding IPI 18838381
GO:0005114 Function Type II transforming growth factor beta receptor binding TAS 18756595
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IDA 10942595, 18756595
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604444 30251 ENSG00000095739
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13145
Protein name BMP and activin membrane-bound inhibitor homolog (Non-metastatic gene A protein) (Putative transmembrane protein NMA)
Protein function Negatively regulates TGF-beta signaling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06211 BAMBI 4 111 BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
Sequence
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHD
VLSPPRGEA
SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
KILSLVHWGMYSGHGKLEFV
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Wnt signaling pathway
TGF-beta signaling pathway
  Downregulation of TGF-beta receptor signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARDIOMEGALY CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CATARACT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEMENTIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Ameloblastoma Ameloblastoma BEFREE 12489181
★☆☆☆☆
Found in Text Mining only
Anemia, Diamond-Blackfan Anemia BEFREE 26258650
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic valve stenosis Pubtator 33963260 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 30556591
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis Pubtator 30320351 Associate
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 30556591
★☆☆☆☆
Found in Text Mining only
Atrioventricular Block Atrioventricular block Pubtator 33963260 Associate
★☆☆☆☆
Found in Text Mining only
Benign Prostatic Hyperplasia Benign Prostatic Hyperplasia BEFREE 31186664
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 19326429
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 16007344 Associate
★☆☆☆☆
Found in Text Mining only