Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25802
Gene name	Leiomodin 1
Gene symbol	LMOD1
Synonyms (NCBI Gene)	1D64kDD1MMIHS3SM-LMODSMLMOD
Chromosome	1
Chromosome location	1q32.1
Summary	The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression o

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs777696417	G>A,C	Pathogenic	Coding sequence variant, stop gained, missense variant

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018126	hsa-miR-335-5p	Microarray	18185580
MIRT1111967	hsa-miR-1253	CLIP-seq
MIRT1111968	hsa-miR-1271	CLIP-seq
MIRT1111969	hsa-miR-1291	CLIP-seq
MIRT1111970	hsa-miR-1293	CLIP-seq
MIRT1111971	hsa-miR-134	CLIP-seq
MIRT1111972	hsa-miR-1343	CLIP-seq
MIRT1111973	hsa-miR-182	CLIP-seq
MIRT1111974	hsa-miR-2861	CLIP-seq
MIRT1111975	hsa-miR-3118	CLIP-seq
MIRT1111976	hsa-miR-3120-5p	CLIP-seq
MIRT1111977	hsa-miR-3140-5p	CLIP-seq
MIRT1111978	hsa-miR-3156-3p	CLIP-seq
MIRT1111979	hsa-miR-3199	CLIP-seq
MIRT1111980	hsa-miR-342-5p	CLIP-seq
MIRT1111981	hsa-miR-346	CLIP-seq
MIRT1111982	hsa-miR-3616-3p	CLIP-seq
MIRT1111983	hsa-miR-3660	CLIP-seq
MIRT1111984	hsa-miR-3667-3p	CLIP-seq
MIRT1111985	hsa-miR-3690	CLIP-seq
MIRT1111986	hsa-miR-4257	CLIP-seq
MIRT1111987	hsa-miR-4264	CLIP-seq
MIRT1111988	hsa-miR-4267	CLIP-seq
MIRT1111989	hsa-miR-4268	CLIP-seq
MIRT1111990	hsa-miR-4288	CLIP-seq
MIRT1111991	hsa-miR-4297	CLIP-seq
MIRT1111992	hsa-miR-4301	CLIP-seq
MIRT1111993	hsa-miR-4308	CLIP-seq
MIRT1111994	hsa-miR-4417	CLIP-seq
MIRT1111995	hsa-miR-4434	CLIP-seq
MIRT1111996	hsa-miR-4437	CLIP-seq
MIRT1111997	hsa-miR-4446-3p	CLIP-seq
MIRT1111998	hsa-miR-4483	CLIP-seq
MIRT1111999	hsa-miR-4513	CLIP-seq
MIRT1112000	hsa-miR-4516	CLIP-seq
MIRT1112001	hsa-miR-4520a-3p	CLIP-seq
MIRT1112002	hsa-miR-4526	CLIP-seq
MIRT1112003	hsa-miR-4531	CLIP-seq
MIRT1112004	hsa-miR-4632	CLIP-seq
MIRT1112005	hsa-miR-4638-3p	CLIP-seq
MIRT1112006	hsa-miR-4642	CLIP-seq
MIRT1112007	hsa-miR-4645-3p	CLIP-seq
MIRT1112008	hsa-miR-4651	CLIP-seq
MIRT1112009	hsa-miR-4656	CLIP-seq
MIRT1112010	hsa-miR-4664-5p	CLIP-seq
MIRT1112011	hsa-miR-4674	CLIP-seq
MIRT1112012	hsa-miR-4721	CLIP-seq
MIRT1112013	hsa-miR-4740-5p	CLIP-seq
MIRT1112014	hsa-miR-4742-5p	CLIP-seq
MIRT1112015	hsa-miR-4763-5p	CLIP-seq
MIRT1112016	hsa-miR-4797-3p	CLIP-seq
MIRT1112017	hsa-miR-483-3p	CLIP-seq
MIRT1112018	hsa-miR-542-3p	CLIP-seq
MIRT1112019	hsa-miR-608	CLIP-seq
MIRT1112020	hsa-miR-626	CLIP-seq
MIRT1112021	hsa-miR-632	CLIP-seq
MIRT1112022	hsa-miR-654-3p	CLIP-seq
MIRT1112023	hsa-miR-942	CLIP-seq
MIRT1112024	hsa-miR-96	CLIP-seq
MIRT2031255	hsa-miR-1238	CLIP-seq
MIRT2031256	hsa-miR-1260	CLIP-seq
MIRT2031257	hsa-miR-1260b	CLIP-seq
MIRT1111972	hsa-miR-1343	CLIP-seq
MIRT2031258	hsa-miR-188-3p	CLIP-seq
MIRT1111974	hsa-miR-2861	CLIP-seq
MIRT1111978	hsa-miR-3156-3p	CLIP-seq
MIRT1111984	hsa-miR-3667-3p	CLIP-seq
MIRT1111991	hsa-miR-4297	CLIP-seq
MIRT2031259	hsa-miR-4446-5p	CLIP-seq
MIRT2031260	hsa-miR-4492	CLIP-seq
MIRT2031261	hsa-miR-4498	CLIP-seq
MIRT2031262	hsa-miR-4505	CLIP-seq
MIRT1112004	hsa-miR-4632	CLIP-seq
MIRT2031263	hsa-miR-4691-5p	CLIP-seq
MIRT2031264	hsa-miR-4727-5p	CLIP-seq
MIRT2031265	hsa-miR-4731-5p	CLIP-seq
MIRT2031266	hsa-miR-4749-3p	CLIP-seq
MIRT1112015	hsa-miR-4763-5p	CLIP-seq
MIRT2031267	hsa-miR-4769-3p	CLIP-seq
MIRT2031268	hsa-miR-4797-5p	CLIP-seq
MIRT2031269	hsa-miR-759	CLIP-seq
MIRT2031270	hsa-miR-762	CLIP-seq
MIRT2031256	hsa-miR-1260	CLIP-seq
MIRT2031257	hsa-miR-1260b	CLIP-seq
MIRT1111972	hsa-miR-1343	CLIP-seq
MIRT2262169	hsa-miR-1827	CLIP-seq
MIRT2031258	hsa-miR-188-3p	CLIP-seq
MIRT2262170	hsa-miR-3151	CLIP-seq
MIRT1111978	hsa-miR-3156-3p	CLIP-seq
MIRT1111982	hsa-miR-3616-3p	CLIP-seq
MIRT2031259	hsa-miR-4446-5p	CLIP-seq
MIRT1112008	hsa-miR-4651	CLIP-seq
MIRT2031264	hsa-miR-4727-5p	CLIP-seq
MIRT2031267	hsa-miR-4769-3p	CLIP-seq
MIRT2031268	hsa-miR-4797-5p	CLIP-seq
MIRT1112019	hsa-miR-608	CLIP-seq
MIRT2031269	hsa-miR-759	CLIP-seq
MIRT2031256	hsa-miR-1260	CLIP-seq
MIRT2031257	hsa-miR-1260b	CLIP-seq
MIRT2031258	hsa-miR-188-3p	CLIP-seq
MIRT1111978	hsa-miR-3156-3p	CLIP-seq
MIRT2031259	hsa-miR-4446-5p	CLIP-seq
MIRT2031264	hsa-miR-4727-5p	CLIP-seq
MIRT2031267	hsa-miR-4769-3p	CLIP-seq
MIRT2390202	hsa-miR-544	CLIP-seq
MIRT2430768	hsa-miR-15a	CLIP-seq
MIRT2430769	hsa-miR-15b	CLIP-seq
MIRT2430770	hsa-miR-16	CLIP-seq
MIRT2430771	hsa-miR-195	CLIP-seq
MIRT2430772	hsa-miR-214	CLIP-seq
MIRT2430773	hsa-miR-3120-3p	CLIP-seq
MIRT2430774	hsa-miR-3619-5p	CLIP-seq
MIRT2430775	hsa-miR-3665	CLIP-seq
MIRT2430776	hsa-miR-424	CLIP-seq
MIRT2430777	hsa-miR-4455	CLIP-seq
MIRT2430778	hsa-miR-497	CLIP-seq
MIRT2430779	hsa-miR-5096	CLIP-seq
MIRT2430780	hsa-miR-532-5p	CLIP-seq
MIRT2430781	hsa-miR-609	CLIP-seq
MIRT2430782	hsa-miR-761	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005523	Function	Tropomyosin binding	IBA
GO:0005523	Function	Tropomyosin binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005865	Component	Striated muscle thin filament	IBA
GO:0005884	Component	Actin filament	ISS
GO:0006936	Process	Muscle contraction	IBA
GO:0007015	Process	Actin filament organization	IBA
GO:0016020	Component	Membrane	TAS	2026759
GO:0030016	Component	Myofibril	IBA
GO:0030016	Component	Myofibril	IDA	26370058
GO:0030016	Component	Myofibril	IEA
GO:0030017	Component	Sarcomere	IEA
GO:0030017	Component	Sarcomere	ISS
GO:0030239	Process	Myofibril assembly	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	26370058
GO:0045010	Process	Actin nucleation	IDA	26370058
GO:0051694	Process	Pointed-end actin filament capping	IEA

MIM	HGNC	e!Ensembl
602715	6647	ENSG00000163431

P29536

Protein name

Leiomodin-1 (64 kDa autoantigen 1D) (64 kDa autoantigen 1D3) (64 kDa autoantigen D1) (Leiomodin, muscle form) (Smooth muscle leiomodin) (SM-Lmod) (Thyroid-associated ophthalmopathy autoantigen)

Protein function

Required for proper contractility of visceral smooth muscle cells (PubMed:28292896). Mediates nucleation of actin filaments.

PDB

4Z79 , 4Z8G , 4Z94

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03250	Tropomodulin	6 → 121	Tropomodulin	Family
PF02205	WH2	571 → 600	WH2 motif	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in lung vascular smooth muscle (at protein level) (PubMed:27144530). Detected in thyroid and extraocular smooth muscle, but not skeletal muscle (PubMed:2026759). Detected in heart, aorta, skeletal muscle, colon, urinary bladde

Sequence

MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQST
GVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSD
LGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEE
RAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGERRNTDTRKEGEKMK
RAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQTPSGPT
KPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFNTV
VKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQ
EQRQAQEAKGEKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPP
LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ

Sequence length

600

Interactions

View interactions

	KEGG		Reactome
	Cytoskeleton in muscle cells		Smooth Muscle Contraction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Megacystis-microcolon-intestinal hypoperistalsis syndrome 3	Pathogenic	rs1487322841, rs1196609413, rs777696417	RCV001796556 RCV001796555 RCV001461845	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thyroid cancer, nonmedullary, 1	Pathogenic	rs777696417	RCV005895420	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Visceral myopathy 1	Pathogenic	rs777696417	RCV000508596	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGACYSTIS MICROCOLON INTESTINAL HYPOPERISTALSIS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGACYSTIS-MICROCOLON-INTESTINAL HYPOPERISTALSIS SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	34852854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28530674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	36292702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28530674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36292702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30786729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30786729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital omphalocele	Congenital omphalocele	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30444878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27386823	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	30444878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	30444878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	9630238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1360432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi anemia	Pubtator	23285130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal megacystis	Fetal megacystis	CLINVAR_DG	28292896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	37511514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11318603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Neoplasm	Cardiac Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	10520227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	LHGDN	10520227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31238169		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	25896974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	25896974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	28893210	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis microcolon intestinal hypoperistalsis syndrome	Berdon syndrome	BEFREE	28292896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis microcolon intestinal hypoperistalsis syndrome	Berdon syndrome	ORPHANET_DG	28292896		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis microcolon intestinal hypoperistalsis syndrome	Megacystis microcolon intestinal hypoperistalsis syndrome	Pubtator	28602422, 33031641	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis-microcolon-intestinal hypoperistalsis syndrome	Megacystis-Microcolon-Intestinal Hypoperistalsis Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microcolon	Microcolon	CLINVAR_DG	28292896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcolon	Microcolon	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	37511514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35488236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	9630238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34860853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27144530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15753209		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	30444878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30988666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35488236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17914110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	18349068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	29453416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral Myopathy	Visceral Myopathy	CLINVAR_DG	28292896		★★★★★ ★☆☆☆☆ Found in Text Mining only

LMOD1 (leiomodin 1)