Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25801
Gene name	Grancalcin
Gene symbol	GCA
Synonyms (NCBI Gene)	GCL
Chromosome	2
Chromosome location	2q24.2
Summary	This gene encodes a calcium-binding protein that is abundant in neutrophils and macrophages. In the absence of divalent cation, this protein localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the pre

231

Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004894	hsa-miR-124-3p	Microarray	15685193
MIRT041484	hsa-miR-193b-3p	CLASH	23622248
MIRT1014179	hsa-miR-1236	CLIP-seq
MIRT1014180	hsa-miR-1245b-3p	CLIP-seq
MIRT1014181	hsa-miR-1276	CLIP-seq
MIRT1014182	hsa-miR-128	CLIP-seq
MIRT1014183	hsa-miR-1321	CLIP-seq
MIRT1014184	hsa-miR-145	CLIP-seq
MIRT1014185	hsa-miR-181a	CLIP-seq
MIRT1014186	hsa-miR-181b	CLIP-seq
MIRT1014187	hsa-miR-181c	CLIP-seq
MIRT1014188	hsa-miR-181d	CLIP-seq
MIRT1014189	hsa-miR-186	CLIP-seq
MIRT1014190	hsa-miR-205	CLIP-seq
MIRT1014191	hsa-miR-2278	CLIP-seq
MIRT1014192	hsa-miR-27a	CLIP-seq
MIRT1014193	hsa-miR-27b	CLIP-seq
MIRT1014194	hsa-miR-300	CLIP-seq
MIRT1014195	hsa-miR-3144-3p	CLIP-seq
MIRT1014196	hsa-miR-3152-3p	CLIP-seq
MIRT1014197	hsa-miR-3162-5p	CLIP-seq
MIRT1014198	hsa-miR-3168	CLIP-seq
MIRT1014199	hsa-miR-3170	CLIP-seq
MIRT1014200	hsa-miR-3187-3p	CLIP-seq
MIRT1014201	hsa-miR-3189-3p	CLIP-seq
MIRT1014202	hsa-miR-3200-3p	CLIP-seq
MIRT1014203	hsa-miR-323-3p	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT1014205	hsa-miR-3609	CLIP-seq
MIRT1014206	hsa-miR-3653	CLIP-seq
MIRT1014207	hsa-miR-3658	CLIP-seq
MIRT1014208	hsa-miR-3684	CLIP-seq
MIRT1014209	hsa-miR-376a	CLIP-seq
MIRT1014210	hsa-miR-376b	CLIP-seq
MIRT1014211	hsa-miR-381	CLIP-seq
MIRT1014212	hsa-miR-3942-3p	CLIP-seq
MIRT1014213	hsa-miR-412	CLIP-seq
MIRT1014214	hsa-miR-4262	CLIP-seq
MIRT1014215	hsa-miR-4263	CLIP-seq
MIRT1014216	hsa-miR-4282	CLIP-seq
MIRT1014217	hsa-miR-4307	CLIP-seq
MIRT1014218	hsa-miR-4311	CLIP-seq
MIRT1014219	hsa-miR-4435	CLIP-seq
MIRT1014220	hsa-miR-4448	CLIP-seq
MIRT1014221	hsa-miR-4477a	CLIP-seq
MIRT1014222	hsa-miR-4511	CLIP-seq
MIRT1014223	hsa-miR-4528	CLIP-seq
MIRT1014224	hsa-miR-4529-5p	CLIP-seq
MIRT1014225	hsa-miR-4659a-3p	CLIP-seq
MIRT1014226	hsa-miR-4659b-3p	CLIP-seq
MIRT1014227	hsa-miR-4666-3p	CLIP-seq
MIRT1014228	hsa-miR-4693-3p	CLIP-seq
MIRT1014229	hsa-miR-4701-5p	CLIP-seq
MIRT1014230	hsa-miR-4739	CLIP-seq
MIRT1014231	hsa-miR-4756-5p	CLIP-seq
MIRT1014232	hsa-miR-4775	CLIP-seq
MIRT1014233	hsa-miR-4777-5p	CLIP-seq
MIRT1014234	hsa-miR-4778-3p	CLIP-seq
MIRT1014235	hsa-miR-4789-5p	CLIP-seq
MIRT1014236	hsa-miR-4799-5p	CLIP-seq
MIRT1014237	hsa-miR-513a-3p	CLIP-seq
MIRT1014238	hsa-miR-513a-5p	CLIP-seq
MIRT1014239	hsa-miR-539	CLIP-seq
MIRT1014240	hsa-miR-548a-5p	CLIP-seq
MIRT1014241	hsa-miR-548ab	CLIP-seq
MIRT1014242	hsa-miR-548ah	CLIP-seq
MIRT1014243	hsa-miR-548ak	CLIP-seq
MIRT1014244	hsa-miR-548b-3p	CLIP-seq
MIRT1014245	hsa-miR-548b-5p	CLIP-seq
MIRT1014246	hsa-miR-548c-5p	CLIP-seq
MIRT1014247	hsa-miR-548d-5p	CLIP-seq
MIRT1014248	hsa-miR-548h	CLIP-seq
MIRT1014249	hsa-miR-548i	CLIP-seq
MIRT1014250	hsa-miR-548j	CLIP-seq
MIRT1014251	hsa-miR-548k	CLIP-seq
MIRT1014252	hsa-miR-548l	CLIP-seq
MIRT1014253	hsa-miR-548s	CLIP-seq
MIRT1014254	hsa-miR-548w	CLIP-seq
MIRT1014255	hsa-miR-548y	CLIP-seq
MIRT1014256	hsa-miR-559	CLIP-seq
MIRT1014257	hsa-miR-576-5p	CLIP-seq
MIRT1014258	hsa-miR-583	CLIP-seq
MIRT1014259	hsa-miR-588	CLIP-seq
MIRT1014260	hsa-miR-590-3p	CLIP-seq
MIRT1014261	hsa-miR-593	CLIP-seq
MIRT1014262	hsa-miR-643	CLIP-seq
MIRT1014263	hsa-miR-671-5p	CLIP-seq
MIRT1014264	hsa-miR-875-5p	CLIP-seq
MIRT2000373	hsa-miR-1208	CLIP-seq
MIRT1014179	hsa-miR-1236	CLIP-seq
MIRT1014182	hsa-miR-128	CLIP-seq
MIRT1014184	hsa-miR-145	CLIP-seq
MIRT1014185	hsa-miR-181a	CLIP-seq
MIRT1014186	hsa-miR-181b	CLIP-seq
MIRT1014187	hsa-miR-181c	CLIP-seq
MIRT1014188	hsa-miR-181d	CLIP-seq
MIRT1014189	hsa-miR-186	CLIP-seq
MIRT2000374	hsa-miR-23a	CLIP-seq
MIRT2000375	hsa-miR-23b	CLIP-seq
MIRT2000376	hsa-miR-23c	CLIP-seq
MIRT1014192	hsa-miR-27a	CLIP-seq
MIRT1014193	hsa-miR-27b	CLIP-seq
MIRT2000377	hsa-miR-3591-3p	CLIP-seq
MIRT2000378	hsa-miR-3680	CLIP-seq
MIRT2000379	hsa-miR-371-5p	CLIP-seq
MIRT1014214	hsa-miR-4262	CLIP-seq
MIRT1014216	hsa-miR-4282	CLIP-seq
MIRT2000380	hsa-miR-4645-5p	CLIP-seq
MIRT2000381	hsa-miR-4662a-5p	CLIP-seq
MIRT2000382	hsa-miR-4668-3p	CLIP-seq
MIRT2000383	hsa-miR-4673	CLIP-seq
MIRT1014234	hsa-miR-4778-3p	CLIP-seq
MIRT2000384	hsa-miR-5096	CLIP-seq
MIRT1014238	hsa-miR-513a-5p	CLIP-seq
MIRT1014240	hsa-miR-548a-5p	CLIP-seq
MIRT1014241	hsa-miR-548ab	CLIP-seq
MIRT1014243	hsa-miR-548ak	CLIP-seq
MIRT1014245	hsa-miR-548b-5p	CLIP-seq
MIRT1014246	hsa-miR-548c-5p	CLIP-seq
MIRT1014247	hsa-miR-548d-5p	CLIP-seq
MIRT1014248	hsa-miR-548h	CLIP-seq
MIRT1014249	hsa-miR-548i	CLIP-seq
MIRT1014250	hsa-miR-548j	CLIP-seq
MIRT1014251	hsa-miR-548k	CLIP-seq
MIRT1014252	hsa-miR-548l	CLIP-seq
MIRT1014254	hsa-miR-548w	CLIP-seq
MIRT1014255	hsa-miR-548y	CLIP-seq
MIRT1014256	hsa-miR-559	CLIP-seq
MIRT2000385	hsa-miR-579	CLIP-seq
MIRT1014261	hsa-miR-593	CLIP-seq
MIRT2000386	hsa-miR-668	CLIP-seq
MIRT1014179	hsa-miR-1236	CLIP-seq
MIRT1014182	hsa-miR-128	CLIP-seq
MIRT1014183	hsa-miR-1321	CLIP-seq
MIRT1014184	hsa-miR-145	CLIP-seq
MIRT2233849	hsa-miR-183	CLIP-seq
MIRT1014189	hsa-miR-186	CLIP-seq
MIRT1014191	hsa-miR-2278	CLIP-seq
MIRT1014192	hsa-miR-27a	CLIP-seq
MIRT1014193	hsa-miR-27b	CLIP-seq
MIRT1014197	hsa-miR-3162-5p	CLIP-seq
MIRT1014203	hsa-miR-323-3p	CLIP-seq
MIRT2233850	hsa-miR-340	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT2000379	hsa-miR-371-5p	CLIP-seq
MIRT2233851	hsa-miR-371b-5p	CLIP-seq
MIRT2233852	hsa-miR-3929	CLIP-seq
MIRT1014213	hsa-miR-412	CLIP-seq
MIRT1014215	hsa-miR-4263	CLIP-seq
MIRT1014216	hsa-miR-4282	CLIP-seq
MIRT2233853	hsa-miR-4419b	CLIP-seq
MIRT2233854	hsa-miR-4476	CLIP-seq
MIRT2233855	hsa-miR-4478	CLIP-seq
MIRT2233856	hsa-miR-4493	CLIP-seq
MIRT2000380	hsa-miR-4645-5p	CLIP-seq
MIRT1014225	hsa-miR-4659a-3p	CLIP-seq
MIRT1014226	hsa-miR-4659b-3p	CLIP-seq
MIRT2000382	hsa-miR-4668-3p	CLIP-seq
MIRT2000383	hsa-miR-4673	CLIP-seq
MIRT2233857	hsa-miR-4698	CLIP-seq
MIRT1014230	hsa-miR-4739	CLIP-seq
MIRT1014231	hsa-miR-4756-5p	CLIP-seq
MIRT1014232	hsa-miR-4775	CLIP-seq
MIRT1014233	hsa-miR-4777-5p	CLIP-seq
MIRT1014234	hsa-miR-4778-3p	CLIP-seq
MIRT1014236	hsa-miR-4799-5p	CLIP-seq
MIRT2233858	hsa-miR-489	CLIP-seq
MIRT2233859	hsa-miR-494	CLIP-seq
MIRT1014238	hsa-miR-513a-5p	CLIP-seq
MIRT1014240	hsa-miR-548a-5p	CLIP-seq
MIRT1014241	hsa-miR-548ab	CLIP-seq
MIRT1014243	hsa-miR-548ak	CLIP-seq
MIRT1014245	hsa-miR-548b-5p	CLIP-seq
MIRT1014246	hsa-miR-548c-5p	CLIP-seq
MIRT1014247	hsa-miR-548d-5p	CLIP-seq
MIRT1014248	hsa-miR-548h	CLIP-seq
MIRT1014249	hsa-miR-548i	CLIP-seq
MIRT1014250	hsa-miR-548j	CLIP-seq
MIRT1014251	hsa-miR-548k	CLIP-seq
MIRT1014252	hsa-miR-548l	CLIP-seq
MIRT2233860	hsa-miR-548n	CLIP-seq
MIRT2233861	hsa-miR-548t	CLIP-seq
MIRT1014254	hsa-miR-548w	CLIP-seq
MIRT1014255	hsa-miR-548y	CLIP-seq
MIRT1014256	hsa-miR-559	CLIP-seq
MIRT2233862	hsa-miR-561	CLIP-seq
MIRT2233863	hsa-miR-569	CLIP-seq
MIRT1014257	hsa-miR-576-5p	CLIP-seq
MIRT2000385	hsa-miR-579	CLIP-seq
MIRT1014260	hsa-miR-590-3p	CLIP-seq
MIRT1014261	hsa-miR-593	CLIP-seq
MIRT2233864	hsa-miR-654-3p	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT1014205	hsa-miR-3609	CLIP-seq
MIRT2450140	hsa-miR-4422	CLIP-seq
MIRT1014242	hsa-miR-548ah	CLIP-seq
MIRT2233861	hsa-miR-548t	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT1014205	hsa-miR-3609	CLIP-seq
MIRT2450140	hsa-miR-4422	CLIP-seq
MIRT1014242	hsa-miR-548ah	CLIP-seq
MIRT2233861	hsa-miR-548t	CLIP-seq
MIRT1014191	hsa-miR-2278	CLIP-seq
MIRT2537780	hsa-miR-3163	CLIP-seq
MIRT2537781	hsa-miR-338-5p	CLIP-seq
MIRT2233850	hsa-miR-340	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT1014205	hsa-miR-3609	CLIP-seq
MIRT2537782	hsa-miR-3613-3p	CLIP-seq
MIRT1014215	hsa-miR-4263	CLIP-seq
MIRT2450140	hsa-miR-4422	CLIP-seq
MIRT1014233	hsa-miR-4777-5p	CLIP-seq
MIRT1014236	hsa-miR-4799-5p	CLIP-seq
MIRT2537783	hsa-miR-501-3p	CLIP-seq
MIRT2537784	hsa-miR-502-3p	CLIP-seq
MIRT1014242	hsa-miR-548ah	CLIP-seq
MIRT2233861	hsa-miR-548t	CLIP-seq
MIRT1014257	hsa-miR-576-5p	CLIP-seq
MIRT1014191	hsa-miR-2278	CLIP-seq
MIRT1014204	hsa-miR-3545-3p	CLIP-seq
MIRT1014205	hsa-miR-3609	CLIP-seq
MIRT2537782	hsa-miR-3613-3p	CLIP-seq
MIRT1014213	hsa-miR-412	CLIP-seq
MIRT1014215	hsa-miR-4263	CLIP-seq
MIRT2450140	hsa-miR-4422	CLIP-seq
MIRT1014233	hsa-miR-4777-5p	CLIP-seq
MIRT1014236	hsa-miR-4799-5p	CLIP-seq
MIRT1014242	hsa-miR-548ah	CLIP-seq
MIRT2233861	hsa-miR-548t	CLIP-seq
MIRT1014257	hsa-miR-576-5p	CLIP-seq
MIRT2233864	hsa-miR-654-3p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	11717497
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	1530588
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	1530588
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS	1530588
GO:0016020	Component	Membrane	IEA
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042803	Function	Protein homodimerization activity	IPI	11717497
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	12804766
GO:0061025	Process	Membrane fusion	TAS	1530588
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

MIM	HGNC	e!Ensembl
607030	15990	ENSG00000115271

P28676

Protein name

Grancalcin

Protein function

Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions.

PDB

1F4O , 1F4Q , 1K94 , 1K95

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected in neutrophils and macrophages (at protein level). Highly expressed in bone marrow. {ECO:0000269|PubMed:1737748}.

Sequence

MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI

Sequence length

217

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30706130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29982782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29982782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18285833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	28397182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10760817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23420841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29554340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	28397182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28077689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27749985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25139485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30170446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12081989, 12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	7501157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29554340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28077689, 28257130		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10A, HYPOHIDROTIC/HAIR/NAIL TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	15461765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 10B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal Dysplasia	BEFREE	15461765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11A, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL DOMINANT	Ectodermal dysplasia	BEFREE	15461765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTODERMAL DYSPLASIA 11B, HYPOHIDROTIC/HAIR/TOOTH TYPE, AUTOSOMAL RECESSIVE	Ectodermal dysplasia	BEFREE	15461765		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	30706130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	21644207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	21839066, 7501157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	23306142, 27636230, 29671039, 29673090, 29707909, 29982782, 31776576, 31848610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	28115189, 9875712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	28379475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27749985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29554340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26643892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27749985, 30170446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23991993, 28077689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21277635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26741700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20015095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	20015095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18285833, 19156166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18285833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	30412104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30929559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28077689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30335521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11692159, 12184809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	11961011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20180881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22479369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23342142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	27631475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40616392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28077689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	28379475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	7501157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31157715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35681439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30667541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20729853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28379475, 29069518, 29506143, 29673090, 29707909, 31665468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27940595, 28077689, 31325308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23843109, 29266882, 29982782		★★★★★ ★☆☆☆☆ Found in Text Mining only

GCA (grancalcin)