Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25793
Gene name	F-box protein 7
Gene symbol	FBXO7
Synonyms (NCBI Gene)	FBXFBX07FBX7PARK15PKPS
Chromosome	22
Chromosome location	22q12.3
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34316445	G>C,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs71799110	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs121918304	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs121918305	C>T	Pathogenic	5 prime UTR variant, genic upstream transcript variant, upstream transcript variant, missense variant, coding sequence variant
rs730880272	G>T	Pathogenic	Splice donor variant
rs749019340	->AA	Pathogenic	Frameshift variant, coding sequence variant
rs1228608709	A>-	Pathogenic	Intron variant, coding sequence variant, 5 prime UTR variant, frameshift variant

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023257	hsa-miR-122-5p	Microarray	17612493
MIRT037372	hsa-miR-877-5p	CLASH	23622248
MIRT440651	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440651	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT992950	hsa-miR-2278	CLIP-seq
MIRT992951	hsa-miR-3125	CLIP-seq
MIRT992952	hsa-miR-3150b-3p	CLIP-seq
MIRT992953	hsa-miR-335	CLIP-seq
MIRT992954	hsa-miR-3916	CLIP-seq
MIRT992955	hsa-miR-3922-5p	CLIP-seq
MIRT992956	hsa-miR-3938	CLIP-seq
MIRT992957	hsa-miR-4270	CLIP-seq
MIRT992958	hsa-miR-4441	CLIP-seq
MIRT992959	hsa-miR-4753-5p	CLIP-seq
MIRT992960	hsa-miR-4784	CLIP-seq
MIRT992961	hsa-miR-518d-5p	CLIP-seq
MIRT992962	hsa-miR-519b-5p	CLIP-seq
MIRT992963	hsa-miR-519c-5p	CLIP-seq
MIRT992964	hsa-miR-520c-5p	CLIP-seq
MIRT992965	hsa-miR-526a	CLIP-seq
MIRT992966	hsa-miR-589	CLIP-seq
MIRT992967	hsa-miR-877	CLIP-seq
MIRT992968	hsa-miR-885-3p	CLIP-seq
MIRT992950	hsa-miR-2278	CLIP-seq
MIRT992951	hsa-miR-3125	CLIP-seq
MIRT992952	hsa-miR-3150b-3p	CLIP-seq
MIRT992953	hsa-miR-335	CLIP-seq
MIRT992954	hsa-miR-3916	CLIP-seq
MIRT992969	hsa-miR-4490	CLIP-seq
MIRT992970	hsa-miR-4511	CLIP-seq
MIRT992971	hsa-miR-4711-5p	CLIP-seq
MIRT992972	hsa-miR-4773	CLIP-seq
MIRT992973	hsa-miR-4774-5p	CLIP-seq
MIRT992960	hsa-miR-4784	CLIP-seq
MIRT992974	hsa-miR-495	CLIP-seq
MIRT992961	hsa-miR-518d-5p	CLIP-seq
MIRT992962	hsa-miR-519b-5p	CLIP-seq
MIRT992963	hsa-miR-519c-5p	CLIP-seq
MIRT992964	hsa-miR-520c-5p	CLIP-seq
MIRT992965	hsa-miR-526a	CLIP-seq
MIRT992975	hsa-miR-548b-3p	CLIP-seq
MIRT992976	hsa-miR-570	CLIP-seq
MIRT992966	hsa-miR-589	CLIP-seq
MIRT992967	hsa-miR-877	CLIP-seq
MIRT2228496	hsa-miR-130a	CLIP-seq
MIRT2228497	hsa-miR-130b	CLIP-seq
MIRT2228498	hsa-miR-141	CLIP-seq
MIRT2228499	hsa-miR-200a	CLIP-seq
MIRT2228500	hsa-miR-219-1-3p	CLIP-seq
MIRT992950	hsa-miR-2278	CLIP-seq
MIRT2228501	hsa-miR-301a	CLIP-seq
MIRT2228502	hsa-miR-301b	CLIP-seq
MIRT2228503	hsa-miR-3065-3p	CLIP-seq
MIRT2228504	hsa-miR-3137	CLIP-seq
MIRT2228505	hsa-miR-3192	CLIP-seq
MIRT992953	hsa-miR-335	CLIP-seq
MIRT2228506	hsa-miR-3591-3p	CLIP-seq
MIRT2228507	hsa-miR-3666	CLIP-seq
MIRT2228508	hsa-miR-3913-3p	CLIP-seq
MIRT992957	hsa-miR-4270	CLIP-seq
MIRT2228509	hsa-miR-4295	CLIP-seq
MIRT2228510	hsa-miR-4314	CLIP-seq
MIRT992958	hsa-miR-4441	CLIP-seq
MIRT2228511	hsa-miR-454	CLIP-seq
MIRT2228512	hsa-miR-4646-5p	CLIP-seq
MIRT2228513	hsa-miR-4703-3p	CLIP-seq
MIRT2228514	hsa-miR-489	CLIP-seq
MIRT992968	hsa-miR-885-3p	CLIP-seq
MIRT2228515	hsa-miR-891b	CLIP-seq
MIRT992951	hsa-miR-3125	CLIP-seq
MIRT2532275	hsa-miR-3158-3p	CLIP-seq
MIRT2532276	hsa-miR-3675-3p	CLIP-seq
MIRT2532277	hsa-miR-3914	CLIP-seq
MIRT992954	hsa-miR-3916	CLIP-seq
MIRT2532278	hsa-miR-3928	CLIP-seq
MIRT2532279	hsa-miR-4446-3p	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	23933751
GO:0000151	Component	Ubiquitin ligase complex	TAS	10531035
GO:0000422	Process	Autophagy of mitochondrion	IMP	23933751
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS	10531035
GO:0005515	Function	Protein binding	IPI	15145941, 16278047, 21378169, 22632967, 23933751, 25029497, 25416956, 25910212, 26496610, 27705803, 28514442, 31515488, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	36646384
GO:0005634	Component	Nucleus	IDA	16510124, 18495667, 21347293, 21378169, 23656991, 25029497, 26310625
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16510124, 21347293, 21378169, 23656991, 25029497
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	23933751, 26310625
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	18495667, 23933751
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	25029497
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	10531035
GO:0006626	Process	Protein targeting to mitochondrion	IMP	23933751
GO:0010975	Process	Regulation of neuron projection development	IMP	25029497
GO:0016567	Process	Protein ubiquitination	IDA	16510124
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	23933751
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	15145941
GO:0019005	Component	SCF ubiquitin ligase complex	TAS	16510124
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	18495667
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16510124
GO:0031647	Process	Regulation of protein stability	IDA	15145941
GO:0032991	Component	Protein-containing complex	IDA
GO:0040012	Process	Regulation of locomotion	IDA	26310625
GO:0043130	Function	Ubiquitin binding	IDA	25029497
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IC	36646384
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	36646384
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045620	Process	Negative regulation of lymphocyte differentiation	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	18495667
GO:0070936	Process	Protein K48-linked ubiquitination	IC	36646384
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	36646384
GO:0097409	Component	Glial cytoplasmic inclusion	IDA	23656991
GO:0097414	Component	Classical Lewy body	IDA	23656991
GO:0097462	Component	Lewy neurite	IDA	23656991
GO:1901526	Process	Positive regulation of mitophagy	IDA	26310625
GO:1901526	Process	Positive regulation of mitophagy	IEA
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	26310625
GO:1903377	Process	Negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IMP	25029497
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IBA
GO:1990037	Component	Lewy body core	IDA	23656991
GO:1990038	Component	Lewy body corona	IDA	23656991
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	15145941, 36646384
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA

MIM	HGNC	e!Ensembl
605648	13586	ENSG00000100225

Q9Y3I1

Protein name

F-box only protein 7

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins and plays a role in several biological processes s

PDB

4L9C , 4L9H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11566	PI31_Prot_N	188 → 322	PI31 proteasome regulator N-terminal	Family
PF00646	F-box	330 → 377	F-box domain	Domain

Sequence

MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDE
ETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQP
SDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVP
HSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMH
PLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD
LQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCR
DLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRP
RFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM

Sequence length

522

Interactions

View interactions

	Reactome
			Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Clear cell carcinoma of kidney	Likely pathogenic	rs762209257	RCV005934959	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FBXO7-related disorder	Likely pathogenic; Pathogenic	rs1290655316	RCV003392591	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioma susceptibility 1	Likely pathogenic	rs762209257	RCV005934958	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Parkinsonian-pyramidal syndrome	Pathogenic; Likely pathogenic	rs1342038737, rs369105683, rs2146009225, rs750398883, rs71799110, rs121918304, rs730880272, rs121918305, rs376455464, rs151103559, rs1370252127, rs778770873, rs2544671633, rs2057587984, rs2057490468 View all (24 more)	RCV001950804 RCV003101279 RCV002226951 RCV003071818 RCV000005077 View all (37 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE EARLY-ONSET	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease, Recessive	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	26010069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26010069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	36233161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37344480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15145941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	38291374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	34791250	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20669327, 20853184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34791250	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of thymus	Congenital Hypoplasia Of Thymus	BEFREE	27915416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	15145941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	27915416, 29124790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	20694531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37344480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32767480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16096642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	20694531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20669327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16610948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26245297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27503909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27689878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37344480	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	36233161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegeneration with brain iron accumulation (NBIA)	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	BEFREE	20694531, 25634434		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEURODEGENERATION WITH BRAIN IRON ACCUMULATION 5	Neurodegeneration With Brain Iron Accumulation	BEFREE	20694531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18513678, 22117566, 32767480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20853184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26245297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	32767480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19038853, 22490479, 23352116, 23485738, 23933751, 24063688, 24107298, 24112787, 25029497, 25197640, 26010069, 26310625, 26882974, 26965690, 27173356 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	26245297, 27503909, 27689878, 33002721, 34148545, 35053314, 36499697, 37874827	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	UNIPROT_DG	18513678, 23933751		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	BEFREE	19038853, 21347293, 24063688, 25169713, 26010069, 30454685, 30840666		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	ORPHANET_DG	19038853		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	GENOMICS_ENGLAND_DG	19038853, 25085748		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	CTD_human_DG	25029497		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	30454685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	20669327, 24063688, 27861377, 32767480, 38466799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	19038853, 20603184, 20669327, 20694531, 20853184, 22166450, 23133663, 23318512, 23352116, 24063688, 24112787, 25169713, 25634434, 27765362, 28341977, 29124790, 29174172, 31144295 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	20853184, 22117566, 33002721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian-pyramidal syndrome	Parkinsonian-Pyramidal Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Parkinsonism, Juvenile	Parkinsonian disease	GENOMICS_ENGLAND_DG	19038853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonism, Juvenile	Parkinsonian disease	BEFREE	25085748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31085610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31085610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	18513678, 27936908, 30454685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Popliteal Pterygium Syndrome	Popliteal pterygium syndrome	Pubtator	32767480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36045381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11, autosomal recessive	Spastic Paraplegia	BEFREE	20694531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	20669327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia type 5A, recessive	Spastic paraplegia	BEFREE	20694531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37742869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	20853184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21695055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	26965690, 27765362, 30232368		★★★★★ ★☆☆☆☆ Found in Text Mining only

FBXO7 (F-box protein 7)