Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	25780
Gene name	RAS guanyl releasing protein 3
Gene symbol	RASGRP3
Synonyms (NCBI Gene)	GRP3
Chromosome	2
Chromosome location	2p22.3
Summary	The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017]

111

Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030769	hsa-miR-21-5p	Microarray	18591254
MIRT662171	hsa-miR-4438	HITS-CLIP	23824327
MIRT654441	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT662170	hsa-miR-3155a	HITS-CLIP	23824327
MIRT662169	hsa-miR-3155b	HITS-CLIP	23824327
MIRT662168	hsa-miR-484	HITS-CLIP	23824327
MIRT654440	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT654439	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT654438	hsa-miR-4267	HITS-CLIP	23824327
MIRT654437	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654436	hsa-miR-4264	HITS-CLIP	23824327
MIRT654435	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654434	hsa-miR-7977	HITS-CLIP	23824327
MIRT654433	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT654432	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT654431	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT654430	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT654441	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT654440	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT654439	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT654438	hsa-miR-4267	HITS-CLIP	23824327
MIRT654437	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654436	hsa-miR-4264	HITS-CLIP	23824327
MIRT654435	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654434	hsa-miR-7977	HITS-CLIP	23824327
MIRT654433	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT654432	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT654431	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT654430	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT483005	hsa-miR-708-3p	PAR-CLIP	23592263
MIRT483004	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT483003	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT483002	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT483001	hsa-miR-765	PAR-CLIP	23592263
MIRT482999	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT483000	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482998	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT439813	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439812	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439813	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439812	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT159273	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT159274	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT159242	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT159246	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT159243	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT159244	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT159250	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT662171	hsa-miR-4438	HITS-CLIP	23824327
MIRT654441	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT662170	hsa-miR-3155a	HITS-CLIP	23824327
MIRT662169	hsa-miR-3155b	HITS-CLIP	23824327
MIRT662168	hsa-miR-484	HITS-CLIP	23824327
MIRT654440	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT654439	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT654438	hsa-miR-4267	HITS-CLIP	23824327
MIRT654437	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654436	hsa-miR-4264	HITS-CLIP	23824327
MIRT654435	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654434	hsa-miR-7977	HITS-CLIP	23824327
MIRT654433	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT654432	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT654431	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT654430	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT654441	hsa-miR-5588-3p	HITS-CLIP	23824327
MIRT654440	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT654439	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT654438	hsa-miR-4267	HITS-CLIP	23824327
MIRT654437	hsa-miR-138-2-3p	HITS-CLIP	23824327
MIRT654436	hsa-miR-4264	HITS-CLIP	23824327
MIRT654435	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT654434	hsa-miR-7977	HITS-CLIP	23824327
MIRT654433	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT654432	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT654431	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT654430	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT483005	hsa-miR-708-3p	PAR-CLIP	23592263
MIRT483004	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT483003	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT483002	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT483001	hsa-miR-765	PAR-CLIP	23592263
MIRT482999	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT483000	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT482998	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT1292417	hsa-miR-3064-3p	CLIP-seq
MIRT1292418	hsa-miR-31	CLIP-seq
MIRT1292419	hsa-miR-3688-5p	CLIP-seq
MIRT1292420	hsa-miR-4722-3p	CLIP-seq
MIRT1292421	hsa-miR-4796-3p	CLIP-seq
MIRT1292422	hsa-miR-520g	CLIP-seq
MIRT1292423	hsa-miR-520h	CLIP-seq
MIRT1292424	hsa-miR-561	CLIP-seq
MIRT1292425	hsa-miR-4494	CLIP-seq
MIRT1292426	hsa-miR-4499	CLIP-seq
MIRT1292427	hsa-miR-4682	CLIP-seq
MIRT2086894	hsa-miR-4659a-3p	CLIP-seq
MIRT2086895	hsa-miR-4659b-3p	CLIP-seq
MIRT2311801	hsa-miR-3065-5p	CLIP-seq
MIRT2311802	hsa-miR-4724-5p	CLIP-seq
MIRT2311803	hsa-miR-4773	CLIP-seq
MIRT2311804	hsa-miR-888	CLIP-seq
MIRT2608212	hsa-miR-103b	CLIP-seq
MIRT2608213	hsa-miR-134	CLIP-seq
MIRT2608214	hsa-miR-3118	CLIP-seq
MIRT2608215	hsa-miR-3164	CLIP-seq
MIRT2608216	hsa-miR-487a	CLIP-seq
MIRT2608212	hsa-miR-103b	CLIP-seq
MIRT2608213	hsa-miR-134	CLIP-seq
MIRT2608214	hsa-miR-3118	CLIP-seq
MIRT2608215	hsa-miR-3164	CLIP-seq
MIRT2608216	hsa-miR-487a	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CREB5	Repression	21132541

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	NAS	10934204
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	10934204
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	10934204
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	10934204
GO:0005886	Component	Plasma membrane	TAS
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	10934204
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0019992	Function	Diacylglycerol binding	NAS	10934204
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0032045	Component	Guanyl-nucleotide exchange factor complex	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
609531	14545	ENSG00000152689

Q8IV61

Protein name

Ras guanyl-releasing protein 3 (Calcium and DAG-regulated guanine nucleotide exchange factor III) (Guanine nucleotide exchange factor for Rap1)

Protein function

Guanine nucleotide exchange factor (GEF) for Ras and Rap1.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00617	RasGEF	155 → 331	RasGEF domain	Family
PF00130	C1_1	495 → 546	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain

Sequence

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYR
NATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDI
SSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRV
HAGVDVVDRGTEFELDQDEGEETRQDGEDG

Sequence length

690

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway B cell receptor signaling pathway Pathways in cancer		Activation of RAS in B cells RAF/MAP kinase cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and oral cavity carcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYSTEM ATROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	30626740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26714738	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24779681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30626740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37013584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19421330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	20736230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25682201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25682201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25682201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25682201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25682201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19421330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21602881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	22687285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20736230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19838193, 26663301, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	19838193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20516000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	24779681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20876802, 24418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24418912, 28486107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24779681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28545823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30626740		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21602881, 29490280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37014739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20876802, 24418912, 24779681, 28864115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28864115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20876802, 24418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20876802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20876802, 24418912, 25189356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	24779681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29048643, 29461644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30106143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28486107, 29490280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	20516000		★★★★★ ★☆☆☆☆ Found in Text Mining only

RASGRP3 (RAS guanyl releasing protein 3)