TINCR (TINCR ubiquitin domain containing)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein Associated diseases
Entrez ID 257000
Gene name TINCR ubiquitin domain containing
Gene symbol TINCR
Synonyms (NCBI Gene)
LINC00036NCRNA00036PLAC2TUBLonco-lncRNA-16
Chromosome 19
Chromosome location 19p13.3
Summary This gene produces a spliced long non-coding RNA that binds RNAs. This transcript interacts with staufen-1 protein to regulate the stability of mRNAs for genes involved in the differentiation of epidermal tissue. Variation in this gene may be associated w
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT732811 hsa-miR-761 Luciferase reporter assayWestern blotting 33654432
MIRT737256 hsa-miR-31-3p qRT-PCRFlow cytometry 32681722
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615241 14607 ENSG00000223573
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A2R8Y7D0
Protein name Ubiquitin domain-containing protein TINCR (Placenta-specific protein 2) (Terminal differentiation-induced cornification regulator)
PDB 7MRJ
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in stratum corneum (at protein level). {ECO:0000269|PubMed:32012357}.
Sequence 
MEGLRRGLSRWKRYHIKVHLADEALLLPLTVRPRDTLSDLRAQLVGQGVSSWKRAFYYNA
RRLDDHQTVRDARLQDGSVLLLVSDPSEAQRLTPAIPALWEAEASRSLESRSSRPAWPTW
Sequence length 120
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
RHEUMATIC HEART DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (48)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 28656268
★★★★★
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 27586866
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 29614984, 30618123, 31447059
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 28738804, 32705168, 33446634, 36725842 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 33084530 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 27586866, 27893425, 33446634, 36385098 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28546230, 31900116, 34057016, 35475470, 36385098 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 27586866
★★★★★
★☆☆☆☆
Found in Text Mining only
Cardiomegaly Cardiomegaly Pubtator 30453794 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 28418933, 30521471, 30853664
★★★★★
★☆☆☆☆
Found in Text Mining only