NPB (neuropeptide B)

Gene

• Entrez ID: 256933
• Gene name: Neuropeptide B
• Gene symbol: NPB
• Synonyms (NCBI Gene): L7, PPL7, PPNPB
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: This gene encodes a member of the neuropeptide B/W family of proteins and preproprotein that is proteolytically processed to generate multiple protein products. The encoded products include neuropeptide B-23 and a C-terminally extended form, neuropeptide

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1190500	hsa-miR-1908	CLIP-seq
MIRT1190501	hsa-miR-296-5p	CLIP-seq
MIRT1190502	hsa-miR-3180	CLIP-seq
MIRT1190503	hsa-miR-3180-3p	CLIP-seq
MIRT1190504	hsa-miR-3196	CLIP-seq
MIRT1190505	hsa-miR-361-3p	CLIP-seq
MIRT1190506	hsa-miR-4447	CLIP-seq
MIRT1190507	hsa-miR-4472	CLIP-seq
MIRT1190508	hsa-miR-4488	CLIP-seq
MIRT1190509	hsa-miR-4697-5p	CLIP-seq
MIRT1190510	hsa-miR-663	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12118011, 12401809
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12118011
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007631	Process	Feeding behavior	IBA

Other IDs

• MIM: 607996
• HGNC: 30099
• e!Ensembl: ENSG00000183979

Protein

• UniProt ID: Q8NG41
• Protein name: Neuropeptide B (Preproprotein L7) (hPPL7) [Cleaved into: Neuropeptide B-23 (NPB23) (hL7); Neuropeptide B-29 (NPB29) (hL7C)]
• Protein function: May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15180	NPBW	6 → 124	Neuropeptides B and W	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hippocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high leve
• Sequence:

  MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYR
  GAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAA
  DCLAA

• Sequence length: 125

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia Nervosa	Anorexia	BEFREE	29984256		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31110527		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40406128	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28760493		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type A	Niemann-Pick Disease	BEFREE	14681755, 16086131		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type B	Niemann-Pick Disease	BEFREE	16802107		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16802107		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Diseases	Sphingomyelinase deficiency	BEFREE	14681755		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only